Nuclear cap-binding protein complex subunit 1 - Saccharomyces cerevisiae S288C

Nuclear cap-binding protein complex subunit 1 (Saccharomyces cerevisiae S288C)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Nuclear cap-binding protein complex subunit 1
Accession Code	P34160
Gene	STO1
Organism	Saccharomyces cerevisiae S288C (Taxonomy: 559292)
Part of Reference Proteome?	Yes
Sequence (Length: 861)
MFNRKRRGDFDEDENYRDFRPRMPKRQRIPPVVQLCKEMMPDIRTIGESVKAFEDDIKFLSEAIMNEYGHEDYFNNALLS TLNAVVVEQPQKQAAIALLTMVVNSKNNVAGKSIINYFFEELQKWCKQTYNDEFKSTSNETGPWNKIKLILRFLSILSPM FLVDELINIYKSLFELSIELNNLDPGNRVPLSEAIYTNTLLNIPYLFFFNRNNDGLRTKVEELLAYVEQNYLVKTTDINL LREYNGEPPYEMVELVRVVLPNVKKALINNLEQLNELFPDWNHLLTPQTGDEGFNDALTLPSVDDLKSFVRLNKNFGSVD SMWKTPRYAFHVYLPNSAGNFETVVPISTYAGQLFNDIIIDLVESLEFNRKEVARQVITLDLFFKAGIFTEPGESIAQLI ATYEENPLAPTFKIEDLAIETILGLIFKLPSVSQPFAYFYTLLVDICQNSPKAIAPVFGRAFRFFYSHLDSLDFELKLRY LDWFSIQMSNFNFSWKWNEWEDDSIKFGKYFYNPKVNFAKNLIQKELRLTSNFSEVEDSLPQEFTKYLDTSYIPRDQLIN YYQSLFTGYTVEEDSVRKNDLYFRQEGVPMENTVRKILDYTHKANNSREVTELESILGELKNEYGSIISDFNRFVIILLV QAVTDSGSRSLSHANKYINDLKEDLKTIFAKIELDIETKEYIIIEAVLTFWNANPQTGFLVADAFKYAGLLTSRTIFTFI FNETGLKNNGLIEATAIEAVFRNLSQQISEENESGNNFEFVFERLCTIANSTIDLLDVNADEDIEIPKVNGEMDIDDIED DKLDLKWKYFTVIGFIKSILRRYSHEYRELADKFIANIDNAIPHESTRRTISNWIQETKEV

Structure Viewer (PDB: 6N7P)

Subcellular Location

Description
Nucleus {Experimental EvidencePubMed:10733586, Experimental EvidencePubMed:10823828, Experimental EvidencePubMed:8858145}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:10823828}. Note=Predominantly nuclear, is able to exit the nucleus in an RNA-dependent manner. {Experimental EvidencePubMed:10823828}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Commitment Complex (GO:0000243) MRNA Cap Binding Complex (GO:0005845) Nuclear Cap Binding Complex (GO:0005846) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Polysome (GO:0005844)

Biology & Function

Description
Component of the CBC complex, which binds co- transcriptionally to the 5'-cap of pre-mRNAs and is involved in maturation, export and degradation of nuclear mRNAs. The CBC complex is required for efficient pre-mRNA splicing through efficient commitment complex and spliceosome formation. Together with NPL3, the CBC complex is required for export of mRNAs out of the nucleus. The CBC complex is also involved in nuclear mRNA degradation, probably by directing the mRNAs to the sites of degradation. Affects replication of the positive- strand RNA virus BMV. {Experimental EvidencePubMed:10490594, Experimental EvidencePubMed:10733586, Experimental EvidencePubMed:10823828, Experimental EvidencePubMed:12756324, Experimental EvidencePubMed:12897126, Experimental EvidencePubMed:14671320, Experimental EvidencePubMed:1512188, Experimental EvidencePubMed:15753296, Experimental EvidencePubMed:16166263, Experimental EvidencePubMed:8811086, Experimental EvidencePubMed:8846890, Experimental EvidencePubMed:8858145, Experimental EvidencePubMed:9499403}.
Assigned Ontology terms

Biological Process	7-Methylguanosine MRNA Capping (GO:0006370) MRNA 3'-End Processing (GO:0031124) MRNA Export From Nucleus (GO:0006406) MRNA Splicing, Via Spliceosome (GO:0000398) MRNA Transcription By RNA Polymerase II (GO:0042789) Nuclear-Transcribed MRNA Catabolic Process (GO:0000956) Nuclear-Transcribed MRNA Catabolic Process, Nonsense-Mediated Decay (GO:0000184) Primary MiRNA Processing (GO:0031053) Response To Osmotic Stress (GO:0006970)
Molecular Function	MRNA Binding (GO:0003729) RNA Cap Binding (GO:0000339)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (5 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P06105	Protein SCP160	EBI-806268	0.35
P20676	Nucleoporin NUP1	EBI-7438784	0.40
Q08920	Nuclear cap-binding protein subunit 2	EBI-806268	0.82
Q02821	Importin subunit alpha	EBI-806268	0.69
Q06142	Importin subunit beta-1	EBI-806268	0.35
Interactions with other proteins (65 interactors)

Partner (UniProt)		IntAct	Confidence score
P40018	Small nuclear ribonucleoprotein-associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB)	EBI-784510	0.35
Q07508	Protein LUC7	EBI-786510	0.35
P53207	U1 small nuclear ribonucleoprotein component SNU71	EBI-787143	0.35
Q03782	56 kDa U1 small nuclear ribonucleoprotein component	EBI-787666	0.35
P53617	Protein NRD1	EBI-787885	0.53
P28320	Splicing factor YJU2	EBI-788628	0.35
Q00916	U1 small nuclear ribonucleoprotein 70 kDa homolog (U1 70K) (U1 snRNP 70 kDa homolog) (U1-70K) (U1 small nuclear ribonucleoprotein SNP1) (U1 snRNP protein SNP1)	EBI-789921	0.35
P39935	Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (Translation initiation factor 4(4)-F(6) subunit gamma(3) protein 1) (eIF4G1) (mRNA cap-binding protein complex subunit p150)	EBI-789934	0.35
P07260	Eukaryotic translation initiation factor 4E (eIF-4E) (eIF4E) (eIF-4F 25 kDa subunit) (mRNA cap-binding protein)	EBI-791281	0.53
Q03776	U1 small nuclear ribonucleoprotein component PRP42 (U1 snRNP protein PRP42) (65 kDa snRNP protein) (Pre-mRNA-processing factor 42)	EBI-792419	0.35
Q00539	Protein NAM8 (Nuclear accommodation of mitochondria protein 8) (U1 snRNP component NAM8)	EBI-793423	0.35
Q02554	Cold sensitive U2 snRNA suppressor 1	EBI-794234	0.35
P38199	Heterogeneous nuclear rnp K-like protein 2 (KH domain-containing protein 1)	EBI-796822	0.35
P54999	Small nuclear ribonucleoprotein F (snRNP-F) (Sm protein F) (Sm-F) (SmF)	EBI-797802	0.35
P10080	Single-stranded nucleic acid-binding protein	EBI-798100	0.35
P40204	Small nuclear ribonucleoprotein G (snRNP-G) (Sm protein G) (Sm-G) (SmG)	EBI-798151	0.35
P32639	Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246)	EBI-798593	0.35
P32605	U1 small nuclear ribonucleoprotein A (U1 snRNP A) (U1-A) (U1A) (Mutant U1 die protein 1)	EBI-800444	0.35
P32588	Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 (ARS consensus-binding protein ACBP-60) (Poly uridylate-binding protein) (Poly(U)-binding protein)	EBI-801532	0.35
P38996	Nuclear polyadenylated RNA-binding protein 3	EBI-802165	0.35
P36036	RNA annealing protein YRA2	EBI-806268	0.56
P39936	Eukaryotic initiation factor 4F subunit p130 (eIF-4F p130) (eIF4F p130) (Translation initiation factor 4(4)-F(6) subunit gamma(3) protein 2) (eIF4G2) (mRNA cap-binding protein complex subunit p130)	EBI-806268	0.35
P02994	Elongation factor 1-alpha (EF-1-alpha) (Eukaryotic elongation factor 1A) (eEF1A) (Translation elongation factor 1A)	EBI-806268	0.35
P10592	Heat shock protein SSA2	EBI-806268	0.53
P25567	RNA-binding protein SRO9 (Suppressor of RHO3 protein 9)	EBI-806268	0.35
P43321	Small nuclear ribonucleoprotein Sm D3 (Sm-D3) (snRNP core protein D3)	EBI-806268	0.35
Q06217	Small nuclear ribonucleoprotein Sm D2 (Sm-D2) (snRNP core protein D2)	EBI-806268	0.35
Q02260	Small nuclear ribonucleoprotein Sm D1 (Sm-D1) (snRNP core protein D1)	EBI-806268	0.35
P23293	Serine/threonine-protein kinase BUR1 (EC 2.7.11.22) (EC 2.7.11.23) (Bypass UAS requirement protein 1) (Suppressor of GPA1-Vall50 mutation protein 1)	EBI-806268	0.35
Q00416	Helicase SEN1 (EC 3.6.4.-) (tRNA-splicing endonuclease positive effector)	EBI-806268	0.35
Q04693	Pre-mRNA-splicing factor RSE1 (RNA splicing and ER to Golgi transport factor 1) (Spliceosome-associated protein 130)	EBI-806268	0.35
P0C0W1	40S ribosomal protein S22-A (RP50) (S24) (Small ribosomal subunit protein uS8-A) (YP58) (YS22)	EBI-806268	0.35
P53552	THO complex subunit 2 (Low dye-binding protein 5) (THO complex subunit RLR1) (Zinc-regulated gene 13 protein)	EBI-806268	0.35
P33334	Pre-mRNA-splicing factor 8	EBI-806268	0.35
P33203	Pre-mRNA-processing protein PRP40	EBI-806268	0.35
P04147	Polyadenylate-binding protein, cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	EBI-806268	0.35
P40965	MutS protein homolog 4	EBI-806268	0.35
P38697	Inosine-5'-monophosphate dehydrogenase 2 (IMP dehydrogenase 2) (IMPD 2) (IMPDH 2) (EC 1.1.1.205)	EBI-806268	0.35
P04911	Histone H2A.1	EBI-806268	0.35
Q05949	Protein BUR2 (Bypass UAS requirement protein 2) (Chromosome stability protein 4)	EBI-806268	0.35
Q12492	Uncharacterized protein YPR064W	EBI-806268	0.35
Q12476	Protein AIR2 (Arginine methyltransferase-interacting RING finger protein 2)	EBI-806268	0.44
Q05900	U1 small nuclear ribonucleoprotein C (U1 snRNP C) (U1-C) (U1C)	EBI-806307	0.56
Q04493	Prefoldin subunit 5 (Genes involved in microtubule biogenesis protein 5) (Gim complex subunit 5) (GimC subunit 5)	EBI-808510	0.35
P32561	Histone deacetylase RPD3 (EC 3.5.1.98) (Transcriptional regulatory protein RPD3)	EBI-808736	0.35
P11633	Non-histone chromosomal protein 6B	EBI-809930	0.35
Q12046	Pre-mRNA-splicing factor CWC2 (Complexed with CEF1 protein 2) (PRP19-associated complex protein 40) (Synthetic lethal with CLF1 protein 3)	EBI-811587	0.35
P32357	A1 cistron-splicing factor AAR2	EBI-812457	0.27
P33322	H/ACA ribonucleoprotein complex subunit CBF5 (EC 5.4.99.-) (Centromere-binding factor 5) (Centromere/microtubule-binding protein CBF5) (H/ACA snoRNP protein CBF5) (Small nucleolar RNP protein CBF5) (p64')	EBI-817668	0.27
P47130	Cop9 signalosome complex subunit 12	EBI-820453	0.27
Q02159	Ubiquitin-conjugating enzyme E2 7 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme 7) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme E2-18 kDa) (Ubiquitin-protein ligase)	EBI-860110	0.00
P53854	Pre-mRNA-splicing factor CWC25 (Complexed with CEF1 protein 25)	EBI-853865	0.35
Q02206	Chromatin structure-remodeling complex subunit RSC4 (RSC complex subunit RSC4) (Remodel the structure of chromatin complex subunit 4)	EBI-6984951	0.40
P32558	FACT complex subunit SPT16 (Cell division control protein 68) (Facilitates chromatin transcription complex subunit SPT16) (Suppressor of Ty protein 16)	EBI-7056803	0.40
P47108	Nucleolar pre-ribosomal-associated protein 2 (Unhealthy ribosome biogenesis protein 2)	EBI-7162654	0.40
Q06677	Auxilin-like clathrin uncoating factor SWA2 (Bud site selection protein 24) (DnaJ-related protein SWA2) (J protein SWA2) (Synthetic lethal with ARF1 protein 2)	EBI-3652626	0.35
P39101	Protein CAJ1	EBI-3654258	0.35
P10591	Heat shock protein SSA1 (Heat shock protein YG100)	EBI-3678092	0.35
P11484	Ribosome-associated molecular chaperone SSB1 (EC 3.6.4.10) (Cold-inducible protein YG101) (Heat shock protein SSB1) (Hsp70 chaperone Ssb)	EBI-3696443	0.35
P39987	Heat shock protein SSC3, mitochondrial (Extracellular mutant protein 10)	EBI-3702075	0.35
P16474	Endoplasmic reticulum chaperone BiP (EC 3.6.4.10) (78 kDa glucose-regulated protein homolog) (GRP-78) (Immunoglobulin heavy chain-binding protein homolog) (BiP)	EBI-3705755	0.35
P0CS90	Import motor subunit, mitochondrial (EC 3.6.4.10) (Endonuclease SceI 75 kDa subunit) (Endo.SceI 75 kDa subunit) (mtHSP70)	EBI-3707131	0.35
P36016	Heat shock protein 70 homolog LHS1 (EC 3.6.1.-)	EBI-3708011	0.35
P39076	T-complex protein 1 subunit beta (TCP-1-beta) (CCT-beta)	EBI-3741611	0.35
P33416	Heat shock protein 78, mitochondrial	EBI-3747483	0.35

Cross-References

Database	Links
UNIPROT	P34160 D6VZU8
PDB	3UKY 6N7P
Pfam	PF02854 PF09088 PF09090

Nuclear cap-binding protein complex subunit 1 (Saccharomyces cerevisiae S288C)

General Information

Protein Information

Structure Viewer (PDB: 6N7P)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (5 interactors)

Interactions with other proteins (65 interactors)

Cross-References

Database

Links

Description

Description