NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

G1/S-specific cyclin-D1 - Rattus norvegicus - NucEnvDB

G1/S-specific cyclin-D1 (Rattus norvegicus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	G1/S-specific cyclin-D1
Accession Code	P39948
Gene	Ccnd1
Organism	Rattus norvegicus \| Norway rat (Taxonomy: 10116)
Part of Reference Proteome?	Yes
Sequence (Length: 295)
MEHQLLCCEVETIRRAYPDTNLLNDRVLRAMLKTEETCAPSVSYFKCVQREIVPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDN SIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEADENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAMQGLNLGSPNNFLSCYRTTHFLSRVIKCDPDCLRACQEQIEALLESSLR QAQQNIDPKATEEEGEVEEEAGLACTPTDVRDVDI

Subcellular Location

Description
Nucleus {By SimilarityUniProtKB:P24385}. Cytoplasm {By SimilarityUniProtKB:P24385}. Nucleus membrane {By SimilarityUniProtKB:P24385}. Note=Cyclin D-CDK4 complexes accumulate at the nuclear membrane and are then translocated into the nucleus through interaction with KIP/CIP family members. {By SimilarityUniProtKB:P24385}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Bicellular Tight Junction (GO:0005923) Cyclin D1-CDK4 Complex (GO:0097128) Cyclin-Dependent Protein Kinase Holoenzyme Complex (GO:0000307) Cytoplasm (GO:0005737) Nuclear Membrane (GO:0031965) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Transcription Repressor Complex (GO:0017053)

Biology & Function

Description
Regulatory component of the cyclin D1-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also a substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin D1/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex. Exhibits transcriptional corepressor activity with INSM1 on the NEUROD1 and INS promoters in a cell cycle-independent manner. {By SimilarityUniProtKB:P24385}.
Assigned Ontology terms

Biological Process	Animal Organ Regeneration (GO:0031100) Cell Division (GO:0051301) Cell Population Proliferation (GO:0008283) Cellular Response To DNA Damage Stimulus (GO:0006974) Cellular Response To Organic Substance (GO:0071310) Endoplasmic Reticulum Unfolded Protein Response (GO:0030968) Fat Cell Differentiation (GO:0045444) G1/S Transition Of Mitotic Cell Cycle (GO:0000082) Lactation (GO:0007595) Leydig Cell Differentiation (GO:0033327) Liver Development (GO:0001889) Liver Regeneration (GO:0097421) Mammary Gland Alveolus Development (GO:0060749) Mammary Gland Epithelial Cell Proliferation (GO:0033598) Mitotic Cell Cycle Phase Transition (GO:0044772) Mitotic G1 DNA Damage Checkpoint Signaling (GO:0031571) Negative Regulation Of Epithelial Cell Differentiation (GO:0030857) Negative Regulation Of Neuron Apoptotic Process (GO:0043524) Negative Regulation Of Transcription By RNA Polymerase II (GO:0000122) Neuron Differentiation (GO:0030182) Positive Regulation Of Cell Population Proliferation (GO:0008284) Positive Regulation Of Cyclin-Dependent Protein Serine/Threonine Kinase Activity (GO:0045737) Positive Regulation Of G1/S Transition Of Mitotic Cell Cycle (GO:1900087) Positive Regulation Of G2/M Transition Of Mitotic Cell Cycle (GO:0010971) Positive Regulation Of Mammary Gland Epithelial Cell Proliferation (GO:0033601) Positive Regulation Of Protein Phosphorylation (GO:0001934) Protein Phosphorylation (GO:0006468) Re-Entry Into Mitotic Cell Cycle (GO:0000320) Regulation Of Catalytic Activity (GO:0050790) Regulation Of Cell Cycle (GO:0051726) Regulation Of Cyclin-Dependent Protein Serine/Threonine Kinase Activity (GO:0000079) Regulation Of G1/S Transition Of Mitotic Cell Cycle (GO:2000045) Response To Calcium Ion (GO:0051592) Response To Corticosterone (GO:0051412) Response To Estradiol (GO:0032355) Response To Estrogen (GO:0043627) Response To Ethanol (GO:0045471) Response To Glucocorticoid (GO:0051384) Response To Iron Ion (GO:0010039) Response To Leptin (GO:0044321) Response To Magnesium Ion (GO:0032026) Response To Organic Cyclic Compound (GO:0014070) Response To Organic Substance (GO:0010033) Response To Organonitrogen Compound (GO:0010243) Response To Steroid Hormone (GO:0048545) Response To UV-A (GO:0070141) Response To Vitamin E (GO:0033197) Response To X-Ray (GO:0010165) Response To Xenobiotic Stimulus (GO:0009410) Wnt Signaling Pathway (GO:0016055)
Molecular Function	Cyclin-Dependent Protein Serine/Threonine Kinase Regulator Activity (GO:0016538) Enzyme Binding (GO:0019899) Histone Deacetylase Binding (GO:0042826) Kinase Activity (GO:0016301) Proline-Rich Region Binding (GO:0070064) Protein Kinase Activity (GO:0004672) Protein Kinase Binding (GO:0019901) Protein-Containing Complex Binding (GO:0044877) Transcription Corepressor Activity (GO:0003714)

Protein-Protein Interactions

Interactions with other proteins (1 interactors)

Partner (UniProt)		IntAct	Confidence score
P63322	Ras-related protein Ral-A (EC 3.6.5.2)	EBI-3956381	0.27

Cross-References

Database	Links
UNIPROT	P39948
Pfam	PF02984 PF00134
PROSITE	PS00292

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK