Importin subunit beta-4 - Saccharomyces cerevisiae S288C

Importin subunit beta-4 (Saccharomyces cerevisiae S288C)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Importin subunit beta-4
Accession Code	P40069
Gene	KAP123
Organism	Saccharomyces cerevisiae S288C (Taxonomy: 559292)
Part of Reference Proteome?	Yes
Sequence (Length: 1113)
MDQQFLSQLEQTLHAITSGVGLKEATKTLQTQFYTQPTTLPALIHILQNGSDDSLKQLAGVEARKLVSKHWNAIDESTRASIKTSLLQTAFSEPKENVRHSNARVIASIGTEELDGNKWPDLVPNLIQTA SGEDVQTRQTAIFILFSLLEDFTSSLSGHIDDFLALFSQTINDPSSLEIRSLSAQALNHVSALIEEQETINPVQAQKFAASIPSVVNVLDAVIKADDTMNAKLIFNCLNDFLLLDSQLTGNFIVDLIKLS LQIAVNSEIDEDVRVFALQFIISSLSYRKSKVSQSKLGPEITVAALKVACEEIDVDDELNNEDETGENEENTPSSSAIRLLAFASSELPPSQVASVIVEHIPAMLQSANVFERRAILLAISVAVTGSPDY ILSQFDKIIPATINGLKDTEPIVKLAALKCIHQLTTDLQDEVAKFHEEYLPLIIDIIDSAKNIVIYNYATVALDGLLEFIAYDAIAKYLDPLMNKLFYMLESNESSKLRCAVVSAIGSAAFAAGSAFIPY FKTSVHYLEKFIQNCSQIEGMSEDDIELRANTFENISTMARAVRSDAFAEFAEPLVNSAYEAIKTDSARLRESGYAFIANLAKVYGENFAPFLKTILPEIFKTLELDEYQFNFDGDAEDLAAFADSANEE ELQNKFTVNTGISYEKEVASAALSELALGTKEHFLPYVEQSLKVLNEQVDESYGLRETALNTIWNVVKSVLLASKVEPESYPKGIPASSYVNADVLAVIQAARETSMGNLSDEFETSMVITVMEDFANMI KQFGAIIIMDNGDSSMLEALCMQVLSVLKGTHTCQTIDIEEDVPRDEELDASETEATLQDVALEVLVSLSQALAGDFAKVFDNFRPVVFGLFQSKSKNKRSSAVGAASELALGMKEQNPFVHEMLEALVI RLTSDKSLEVRGNAAYGVGLLCEYASMDISAVYEPVLKALYELLSAADQKALAAEDDEATREIIDRAYANASGCVARMALKNSALVPLEQTVPALLAHLPLNTGFEEYNPIFELIMKLYQENSPVITNET PRIIEIFSAVFTKENDRIKLEKESTLGREENMERLKQFQTEEMKHKVIELLKYLNTTYNGIVAQNPVLAAVIA

Subcellular Location

Description
Cytoplasm {Experimental EvidencePubMed:9238021, Experimental EvidencePubMed:9321403}. Nucleus {Experimental EvidencePubMed:9238021, Experimental EvidencePubMed:9321403}. Nucleus, nuclear pore complex {Experimental EvidencePubMed:9321403}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Pore Complex	SL-0185	The nuclear pore complex (NPC) constitutes the exclusive means of nucleocytoplasmic transport. NPCs allow the passive diffusion of ions and small molecules and the active bidirectional transport of macromolecules such as proteins, RNAs etc across the double-membrane nuclear envelope.The NPC is composed of at least 30 distinct subunits known as Nucleoporins (NUPs).
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Cytoplasmic Stress Granule (GO:0010494) Nuclear Pore (GO:0005643) Nucleus (GO:0005634)

Biology & Function

Description
Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Its predominant cargo substrate seems to be ribosomal proteins (PubMed:9321403). Required for import of the ribosomal assembly factor NMD3 (PubMed:12612077). May be involved in nuclear transport of YAP1 (PubMed:11274141). Mediates the nuclear import of histones H3 and H4 (PubMed:11694505). Mediates docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to repeat-containing nucleoporins. The complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism (PubMed:11423015). At the nucleoplasmic side of the NPC, GTP- Ran binding leads to release of the cargo (PubMed:9321403). The importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (PubMed:11423015). {Experimental EvidencePubMed:11274141, Experimental EvidencePubMed:12612077, Experimental EvidencePubMed:9321403, Curator InferencePubMed:11423015}.
Assigned Ontology terms

Biological Process	MRNA Transport (GO:0051028) NLS-Bearing Protein Import Into Nucleus (GO:0006607) Protein Import Into Nucleus (GO:0006606) Regulation Of Pseudohyphal Growth (GO:2000220)
Molecular Function	Nuclear Import Signal Receptor Activity (GO:0061608) Nuclear Localization Sequence Binding (GO:0008139) Small GTPase Binding (GO:0031267)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (14 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P32499	Nucleoporin NUP2	EBI-801825	0.35
P34077	Nucleoporin NIC96	EBI-789044	0.35
P39705	Nucleoporin NUP60	EBI-810484	0.67
Q06616	Nuclear envelope protein YPR174C	EBI-794693	0.53
P47054	Nucleoporin NUP192	EBI-809765	0.35
P52593	Nucleoporin NUP188	EBI-809801	0.35
P40075	Vesicle-associated membrane protein-associated protein SCS2	EBI-7043141	0.35
Q12063	Dehydrodolichyl diphosphate synthase complex subunit NUS1	EBI-16287555	0.35
P38242	UDP-N-acetylglucosamine transferase subunit ALG14	EBI-804270	0.35
P12683	3-hydroxy-3-methylglutaryl-coenzyme A reductase 1	EBI-786893	0.35
P12684	3-hydroxy-3-methylglutaryl-coenzyme A reductase 2	EBI-787291	0.35
Q02821	Importin subunit alpha	EBI-804491	0.53
Q06142	Importin subunit beta-1	EBI-784458	0.35
P38217	Importin subunit beta-2	EBI-810745	0.35
Interactions with other proteins (199 interactors)

Partner (UniProt)		IntAct	Confidence score
P39935	Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (Translation initiation factor 4(4)-F(6) subunit gamma(3) protein 1) (eIF4G1) (mRNA cap-binding protein complex subunit p150)	EBI-7102517	0.40
P38720	6-phosphogluconate dehydrogenase, decarboxylating 1 (EC 1.1.1.44)	EBI-738927	0.35
P33892	eIF-2-alpha kinase activator GCN1 (General control non-derepressible protein 1) (Translational activator GCN1)	EBI-784561	0.35
P40499	Protein ICE2 (Inheritance of cortical ER protein 2)	EBI-784605	0.35
P16522	Anaphase-promoting complex subunit CDC23 (Cell division control protein 23)	EBI-784904	0.35
P53012	Acyl-coenzyme A diphosphatase SCS3 (EC 3.6.1.-) (FIT family protein SCS3)	EBI-784913	0.35
Q02785	ATP-dependent permease PDR12	EBI-785248	0.35
P38310	Iron transporter FTH1	EBI-785385	0.35
P36013	NAD-dependent malic enzyme, mitochondrial (NAD-ME) (EC 1.1.1.38)	EBI-785404	0.35
P38085	Valine/tyrosine/tryptophan amino-acid permease 1 (Tyrosine and tryptophan amino acid transporter 1)	EBI-785720	0.35
P20107	Zinc/cadmium resistance protein	EBI-786095	0.35
P53742	Nucleolar GTP-binding protein 2	EBI-786111	0.35
P07262	NADP-specific glutamate dehydrogenase 1 (NADP-GDH 1) (EC 1.4.1.4) (NADP-dependent glutamate dehydrogenase 1)	EBI-786325	0.35
P32454	Aminopeptidase 2, mitochondrial (AP-II) (Aminopeptidase II) (EC 3.4.11.-) (YscII)	EBI-786482	0.35
P35723	Endoplasmic reticulum transmembrane protein 1	EBI-786542	0.35
P32905	40S ribosomal protein S0-A (Nucleic acid-binding protein NAB1A) (Small ribosomal subunit protein uS2-A)	EBI-786584	0.53
P33441	THO complex subunit MFT1 (Mitochondrial fusion target protein 1)	EBI-786653	0.35
P21147	Acyl-CoA desaturase 1 (EC 1.14.19.1) (Delta 9 fatty acid desaturase) (Fatty acid desaturase 1) (Stearoyl-CoA desaturase 1)	EBI-786767	0.35
P52910	Acetyl-coenzyme A synthetase 2 (EC 6.2.1.1) (Acetate--CoA ligase 2) (Acyl-activating enzyme 2)	EBI-787020	0.35
P42842	Essential for maintenance of the cell wall protein 1	EBI-787059	0.53
P11075	Protein transport protein SEC7	EBI-787105	0.35
P38152	Tricarboxylate transport protein (Citrate transport protein) (CTP)	EBI-787191	0.35
Q99190	Very-long-chain enoyl-CoA reductase (EC 1.3.1.93) (Enoyl reductase TSC13) (Temperature-sensitive CSG2 suppressor protein 13) (Trans-2-enoyl-CoA reductase)	EBI-787497	0.35
P32798	Cobalt uptake protein COT1	EBI-787527	0.35
P18414	ER lumen protein-retaining receptor (Endoplasmic reticulum retention defective protein 2) (HDEL receptor)	EBI-787591	0.35
P40060	Ino eighty subunit 5	EBI-787692	0.35
Q12029	Sideroflexin FSF1 (Fungal sideroflexin-1)	EBI-787943	0.35
Q04013	Citrate/oxoglutarate carrier protein (Coc1p) (Mitochondrial DNA replication protein YHM2)	EBI-787999	0.53
Q12345	Ino eighty subunit 3	EBI-788466	0.35
P04840	Mitochondrial outer membrane protein porin 1 (Voltage-dependent anion-selective channel protein 1) (VDAC-1)	EBI-789381	0.53
P22211	Nitrogen permease reactivator protein (EC 2.7.11.1) (Serine/threonine-protein kinase NPR1)	EBI-789829	0.35
P00546	Cyclin-dependent kinase 1 (CDK1) (EC 2.7.11.22) (Cell division control protein 28) (Cell division protein kinase 1)	EBI-790005	0.35
P53045	C-4 methylsterol oxidase ERG25 (EC 1.14.18.-) (Ergosterol biosynthetic protein 25) (Sterol-C4-methyl oxidase ERG25) (SMO)	EBI-790631	0.35
P38719	ATP-dependent RNA helicase DBP8 (EC 3.6.4.13) (DEAD box protein 8)	EBI-791466	0.53
P35191	DnaJ homolog 1, mitochondrial	EBI-791750	0.35
P39743	Reduced viability upon starvation protein 167	EBI-791998	0.53
P40541	Cohesin subunit SCC3 (Irregular cell behavior protein 1)	EBI-792117	0.35
P33333	1-acyl-sn-glycerol-3-phosphate acyltransferase (1-AGP acyltransferase) (1-AGPAT) (EC 2.3.1.23) (EC 2.3.1.51) (EC 2.3.1.n7) (Lysophosphatidic acid acyltransferase) (LPAAT) (Sphingolipid compensation protein 1)	EBI-792539	0.35
P32476	Squalene epoxidase ERG1 (SE) (EC 1.14.14.17) (Ergosterol biosynthetic protein 1) (Squalene monooxygenase ERG1)	EBI-792746	0.35
P32467	Low-affinity glucose transporter HXT4 (Low-affinity glucose transporter LGT1)	EBI-792844	0.35
P32803	Endosomal protein P24B (24 kDa endomembrane protein) (Basic 24 kDa late endocytic intermediate component)	EBI-792992	0.35
P38853	Kelch repeat-containing protein 1	EBI-793202	0.35
P28496	Ceramide synthase LAC1 (Very-long-chain ceramide synthase LAC1) (EC 2.3.1.297)	EBI-793629	0.35
P07279	60S ribosomal protein L18-A (Large ribosomal subunit protein eL18-A) (RP28)	EBI-793825	0.35
P53965	Inositol phosphatase SIW14 (EC 3.6.1.52) (5-PP-InsP phosphatase) (Inositol pyrophosphate phosphatase SIW14) (Oxidant-induced cell-cycle arrest protein 3) (Synthetic interaction with WHI2 protein 14)	EBI-794192	0.35
P36008	Elongation factor 1-gamma 2 (EF-1-gamma 2) (Eukaryotic elongation factor 1Bgamma 2) (eEF1Bgamma 2) (Translation elongation factor 1B gamma 2)	EBI-794719	0.35
P53217	Uncharacterized membrane protein YGR026W	EBI-795519	0.35
P39522	Dihydroxy-acid dehydratase, mitochondrial (DAD) (EC 4.2.1.9)	EBI-796511	0.35
P48563	Protein MON2	EBI-796544	0.35
P40416	Iron-sulfur clusters transporter ATM1, mitochondrial (EC 7.-.-.-)	EBI-796874	0.35
P41940	Mannose-1-phosphate guanyltransferase (EC 2.7.7.13) (ATP-mannose-1-phosphate guanylyltransferase) (GDP-mannose pyrophosphorylase) (NDP-hexose pyrophosphorylase)	EBI-797068	0.35
P32629	Mannan polymerase II complex ANP1 subunit (M-Pol II subunit ANP1) (Aminonitrophenyl propanediol resistance protein)	EBI-797496	0.35
P28003	SWIRM domain-containing protein FUN19	EBI-797693	0.63
Q07084	Osmolarity two-component system protein SSK1	EBI-797765	0.35
Q07804	Sterol esterase 1 (EC 3.1.1.13) (Steryl ester hydrolase 1)	EBI-797939	0.35
P38707	Asparagine--tRNA ligase, cytoplasmic (EC 6.1.1.22) (Asparaginyl-tRNA synthetase) (AsnRS)	EBI-798527	0.35
P36148	Glycerol-3-phosphate O-acyltransferase 2 (G-3-P acyltransferase 2) (GPAT 2) (EC 2.3.1.15) (Dihydroxyacetone phosphate acyltransferase 2) (DHAP-AT 2) (EC 2.3.1.42) (Glycerol-3-phosphate / dihydroxyacetone phosphate acyltransferase 2)	EBI-798681	0.35
P12385	Eukaryotic peptide chain release factor subunit 1 (Eukaryotic release factor 1) (eRF1) (Omnipotent suppressor protein 1)	EBI-798708	0.35
P54837	Endoplasmic reticulum vesicle protein 25	EBI-798956	0.35
P38703	Ceramide synthase LAG1 (Longevity assurance factor 1) (Longevity assurance gene 1 protein) (Longevity assurance protein 1) (Very-long-chain ceramide synthase LAG1) (EC 2.3.1.297)	EBI-799064	0.35
P29496	Minichromosome maintenance protein 5 (EC 3.6.4.12) (Cell division control protein 46)	EBI-799159	0.35
Q07560	Cardiolipin synthase (CMP-forming) (CLS) (EC 2.7.8.41)	EBI-799843	0.35
P16550	Protein APA1 [Includes: Diadenosine 5',5'''-P1,P4-tetraphosphate phosphorylase 1 (Ap4A phosphorylase 1) (EC 2.7.7.53) (ADP-sulfurylase) (EC 2.7.7.5) (ATP adenylyltransferase) (Diadenosine tetraphosphate alpha,beta-phosphorylase (ADP-forming))]	EBI-799867	0.35
P38687	Signal recognition particle subunit SRP68 (Signal recognition particle 68 kDa protein homolog)	EBI-800067	0.35
P23500	Mitochondrial RNA-splicing protein MRS4	EBI-800292	0.35
P05626	ATP synthase subunit 4, mitochondrial	EBI-800337	0.40
P53881	54S ribosomal protein L22, mitochondrial (Mitochondrial large ribosomal subunit protein uL22m)	EBI-800899	0.35
P02309	Histone H4	EBI-801642	0.53
Q04182	ATP-dependent permease PDR15	EBI-802063	0.35
Q02336	Transcriptional adapter 2	EBI-802105	0.35
P40495	Homoisocitrate dehydrogenase, mitochondrial (HIcDH) (EC 1.1.1.87)	EBI-802128	0.35
P50108	Probable alpha-1,6-mannosyltransferase MNN10 (EC 2.4.1.-) (Bud emergence delay protein 1) (Mannan polymerase II complex MNN10 subunit) (M-Pol II subunit MNN10)	EBI-802587	0.53
P33748	Zinc finger protein MSN2 (Multicopy suppressor of SNF1 protein 2)	EBI-802616	0.35
P46985	Probable alpha-1,6-mannosyltransferase MNN11 (EC 2.4.1.-) (Mannan polymerase II complex MNN11 subunit) (M-Pol II subunit MNN11)	EBI-802682	0.35
P22202	Heat shock protein SSA4	EBI-802717	0.35
P32903	Plasma membrane ATPase proteolipid 1	EBI-802959	0.35
P39704	Protein ERP2	EBI-803225	0.35
P32843	Mitochondrial escape protein 2 (Protein RNA12)	EBI-803607	0.35
P0CI39	Pheromone alpha factor receptor	EBI-803823	0.35
Q12680	Glutamate synthase [NADH] (EC 1.4.1.14) (NADH-GOGAT)	EBI-804008	0.35
P22215	Uncharacterized transporter SLY41	EBI-804242	0.35
Q03771	Assembly chaperone of RPL4	EBI-804362	0.35
Q04305	U3 small nucleolar RNA-associated protein 15 (U3 snoRNA-associated protein 15) (U three protein 15) (U3 protein 15 required for transcription) (t-UTP15)	EBI-804878	0.35
P39969	Protein BOI2 (Protein BEB1)	EBI-805048	0.35
P40035	Mitochondrial phosphate carrier protein 2 (Phosphate transport protein 2) (PTP 2) (Pi carrier isoform 2) (mPic 2)	EBI-805054	0.35
Q12296	Protein MAM3	EBI-805165	0.35
P40970	Serine palmitoyltransferase 2 (SPT 2) (EC 2.3.1.50) (Long chain base biosynthesis protein 2)	EBI-805812	0.35
P38264	SRP-independent targeting protein 3 (Inorganic phosphate transport protein PHO88) (Phosphate metabolism protein PHO88)	EBI-806188	0.35
P39676	Flavohemoprotein (EC 1.14.12.17) (Flavohemoglobin) (Hemoglobin-like protein) (Nitric oxide dioxygenase) (NO oxygenase) (NOD)	EBI-806418	0.35
P25360	Inorganic phosphate transporter PHO87	EBI-806544	0.35
P35200	Protein UPS2, mitochondrial (Altered inheritance rate of mitochondrion protein 30) (Genetic interactor of prohibitins protein 1) (Unprocessed MGM1 protein 2)	EBI-806623	0.35
P39004	High-affinity hexose transporter HXT7	EBI-806863	0.35
P40319	Elongation of fatty acids protein 3 (EC 2.3.1.199) (3-keto acyl-CoA synthase ELO3) (Affecting plasma membrane ATPase activity protein 1) (Suppressor of RAD3 essential function protein 1) (Suppressor of Rvs161 and Rvs167 mutations protein 4) (Very-long-chain 3-oxoacyl-CoA synthase 3) (v-SNARE bypass mutant gene 1 protein)	EBI-807008	0.35
P32340	Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial (EC 1.6.5.9) (Internal NADH dehydrogenase) (NADH:ubiquinone reductase (non-electrogenic))	EBI-807081	0.35
P39715	Shuttling pre-60S factor ECM1 (Extracellular mutant protein 1) (Protein SIM1)	EBI-807214	0.35
P07246	Alcohol dehydrogenase 3, mitochondrial (EC 1.1.1.1) (Alcohol dehydrogenase III) (YADH-3)	EBI-807320	0.35
Q05881	Uncharacterized protein YLR287C	EBI-807421	0.35
P32502	Translation initiation factor eIF-2B subunit beta (GCD complex subunit GCD7) (Guanine nucleotide exchange factor subunit GCD7) (eIF-2B GDP-GTP exchange factor subunit beta)	EBI-807537	0.35
Q12449	Hsp90 co-chaperone AHA1 (Activator of Hsp90 ATPase protein 1)	EBI-807743	0.44
P25454	DNA repair protein RAD51	EBI-807992	0.35
P21304	Periodic tryptophan protein 1	EBI-808083	0.35
P46956	Inorganic phosphate transporter PHO86	EBI-808284	0.53
P13663	Aspartate-semialdehyde dehydrogenase (ASA dehydrogenase) (ASADH) (EC 1.2.1.11) (Aspartate-beta-semialdehyde dehydrogenase)	EBI-808333	0.35
Q04062	26S proteasome regulatory subunit RPN9 (Proteasome non-ATPase subunit 7)	EBI-808625	0.35
P27929	37S ribosomal protein NAM9, mitochondrial (Mitochondrial small ribosomal subunit protein uS4m) (Nuclear accommodation of mitochondria protein 9)	EBI-808974	0.35
P38689	Ribose-phosphate pyrophosphokinase 3 (EC 2.7.6.1) (Phosphoribosyl pyrophosphate synthase 3)	EBI-809021	0.35
P40081	Putative magnesium-dependent phosphatase YER134C (EC 3.1.3.48)	EBI-809045	0.35
P51998	54S ribosomal protein YmL6, mitochondrial (Mitochondrial large ribosomal subunit protein uL4m)	EBI-809221	0.35
P04451	60S ribosomal protein L23-A (L17a) (Large ribosomal subunit protein uL14-A) (YL32)	EBI-809374	0.35
Q03529	Ceramide very long chain fatty acid hydroxylase SCS7 (Ceramide VLCFA hydroxylase SCS7) (4-hydroxysphinganine ceramide fatty acyl 2-hydroxylase SCS7) (EC 1.14.18.6) (Dihydroceramide fatty acyl 2-hydroxylase SCS7) (EC 1.14.18.7) (Sphingolipid alpha-hydroxylase) (Suppressor of calcium sensitivity 7)	EBI-810338	0.35
P32492	Myosin-4 (SWI5-dependent HO expression protein 1)	EBI-810383	0.35
P38706	60S ribosomal protein L27-A (Large ribosomal subunit protein eL27-A)	EBI-810484	0.35
P41805	60S ribosomal protein L10 (L9) (Large ribosomal subunit protein uL16) (Ubiquinol-cytochrome C reductase complex subunit VI-requiring protein)	EBI-810484	0.35
P40010	Nuclear GTP-binding protein NUG1 (Nuclear GTPase 1)	EBI-810484	0.35
P25605	Acetolactate synthase small subunit, mitochondrial (Acetohydroxy-acid synthase small subunit) (AHAS) (ALS)	EBI-810484	0.35
P28241	Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial (EC 1.1.1.41) (Isocitric dehydrogenase) (NAD(+)-specific ICDH)	EBI-810484	0.35
Q12159	RNA annealing protein YRA1	EBI-810484	0.53
P07259	Protein URA2 [Includes: Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2)]	EBI-810484	0.35
P10081	ATP-dependent RNA helicase eIF4A (EC 3.6.4.13) (Eukaryotic initiation factor 4A) (eIF-4A) (Stimulator factor I 37 kDa component) (Translation initiation factor 1/2) (p37)	EBI-810484	0.56
P02994	Elongation factor 1-alpha (EF-1-alpha) (Eukaryotic elongation factor 1A) (eEF1A) (Translation elongation factor 1A)	EBI-810484	0.35
P40150	Ribosome-associated molecular chaperone SSB2 (EC 3.6.4.10) (Heat shock protein SSB2) (Hsp70 chaperone Ssb)	EBI-810484	0.35
P11484	Ribosome-associated molecular chaperone SSB1 (EC 3.6.4.10) (Cold-inducible protein YG101) (Heat shock protein SSB1) (Hsp70 chaperone Ssb)	EBI-810484	0.53
P10592	Heat shock protein SSA2	EBI-810484	0.35
Q12464	RuvB-like protein 2 (RUVBL2) (EC 3.6.4.12) (TIP49-homology protein 2) (TIP49b homolog)	EBI-810484	0.35
P26783	40S ribosomal protein S5 (RP14) (S2) (Small ribosomal subunit protein uS7) (YS8)	EBI-810484	0.53
P05753	40S ribosomal protein S4-B (RP5) (S7) (Small ribosomal subunit protein eS4-B) (YS6)	EBI-810484	0.35
P23248	40S ribosomal protein S1-B (RP10B) (Small ribosomal subunit protein eS1-B)	EBI-810484	0.53
P33442	40S ribosomal protein S1-A (RP10A) (Small ribosomal subunit protein eS1-A)	EBI-810484	0.53
P35271	40S ribosomal protein S18-A (Small ribosomal subunit protein uS13-A)	EBI-810484	0.35
P26781	40S ribosomal protein S11-A (RP41) (S18) (Small ribosomal subunit protein uS17-A) (YS12)	EBI-810484	0.35
P32566	Cell wall assembly regulator SMI1 (Killer toxin-resistance protein 4)	EBI-811327	0.35
P39011	GTPase-GDP dissociation stimulator BEM4 (Bud emergence protein 4)	EBI-811463	0.35
P19262	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) (OGDC-E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex)	EBI-812031	0.35
Q06338	Protein BCP1	EBI-812996	0.27
P18239	ADP,ATP carrier protein 2 (ADP/ATP translocase 2) (Adenine nucleotide translocator 2) (ANT 2) (Petite colonies protein 9)	EBI-816585	0.51
P54115	Magnesium-activated aldehyde dehydrogenase, cytosolic (EC 1.2.1.-) (EC 1.2.1.4) (Mg(2+)-activated acetaldehyde dehydrogenase) (Mg(2+)-ACDH)	EBI-819644	0.27
P36046	Mitochondrial intermembrane space import and assembly protein 40 (Mitochondrial import inner membrane translocase TIM40)	EBI-853469	0.35
Q02776	Mitochondrial import inner membrane translocase subunit TIM50	EBI-853768	0.35
P47077	Nucleolar protein 9 (Pumilio domain-containing protein NOP9)	EBI-854045	0.35
P47026	GPI-anchored wall transfer protein 1 (EC 2.3.-.-)	EBI-854100	0.35
P0CG63	Polyubiquitin [Cleaved into: Ubiquitin]	EBI-7480729	0.44
A0A023PZH5	Putative uncharacterized membrane protein YMR290W-A	EBI-7178717	0.40
P53921	54S ribosomal protein bL35m (Mitochondrial large ribosomal subunit protein bL35m)	EBI-7182619	0.40
Q08204	Structural maintenance of chromosomes protein 5	EBI-7707649	0.40
P38789	Ribosome biogenesis protein SSF1	EBI-7763954	0.40
P36100	Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit)	EBI-7778406	0.40
Q05050	Eisosome protein 1	EBI-8090720	0.40
P38692	Serine/threonine-protein kinase KIC1 (EC 2.7.11.1) (Kinase that interacts with CDC31) (N-rich kinase 1)	EBI-2610613	0.35
P32790	Actin cytoskeleton-regulatory complex protein SLA1	EBI-7513567	0.37
P61830	Histone H3	EBI-2884222	0.00
P04912	Histone H2A.2	EBI-2884694	0.00
Q12692	Histone H2A.Z	EBI-2885248	0.00
Q12529	Potential protein lysine methyltransferase SET6 (EC 2.1.1.-) (SET domain-containing protein 6)	EBI-2887496	0.00
Q04477	Kinetochore protein SPC24	EBI-2887856	0.00
P46675	Protein STU2 (Suppressor of tubulin 2)	EBI-2888241	0.00
P40340	ATPase histone chaperone YTA7 (EC 3.6.1.-) (ATPase family AAA domain-containing protein YTA7) (AAA-ATPase) (Tat-binding homolog 7)	EBI-2889086	0.00
P52919	NAP1-binding protein	EBI-7042905	0.63
B5VKC0	Endoplasmic reticulum junction formation protein lunapark	EBI-7043141	0.35
P0CX39	40S ribosomal protein S8-A (RP19) (S14) (Small ribosomal subunit protein eS8-A) (YS9)	EBI-7043141	0.35
P23641	Mitochondrial phosphate carrier protein (Mitochondrial import receptor) (Phosphate transport protein) (PTP) (mPic 1) (p32) [Cleaved into: Mitochondrial phosphate carrier protein, N-terminally processed]	EBI-7043141	0.35
P32332	Mitochondrial oxaloacetate transport protein (Mitochondrial carrier protein PMT)	EBI-7043141	0.35
P39926	Protein SSO2	EBI-7043141	0.35
P38555	GTP-binding protein YPT31/YPT8 (Rab GTPase YPT31)	EBI-7043141	0.35
P21560	Protein CBP3, mitochondrial	EBI-7043141	0.35
P17076	60S ribosomal protein L8-A (L4) (L4-2) (L7a-1) (Large ribosomal subunit protein eL8-A) (Maintenance of killer protein 7) (RP6) (YL5)	EBI-7043141	0.35
P25294	Protein SIS1	EBI-7043141	0.35
P18238	ADP,ATP carrier protein 3 (ADP/ATP translocase 3) (Adenine nucleotide translocator 3) (ANT 3)	EBI-7043141	0.35
P47124	Putative glycosyltransferase HOC1 (EC 2.4.-.-) (M-Pol II subunit Hoc1p) (Mannan polymerase II complex HOC1 subunit)	EBI-7043141	0.35
P00359	Glyceraldehyde-3-phosphate dehydrogenase 3 (GAPDH 3) (EC 1.2.1.12)	EBI-7043141	0.35
P38130	Probable mannosyltransferase KTR3 (EC 2.4.1.-)	EBI-7043141	0.35
Q04947	Reticulon-like protein 1	EBI-7043141	0.35
Q12690	60S ribosomal protein L13-A (Large ribosomal subunit protein eL13-A)	EBI-7043141	0.35
P25087	Sterol 24-C-methyltransferase ERG6 (SCMT) (EC 2.1.1.41) (Delta(24)-sterol C-methyltransferase ERG6) (Ergosterol biosynthetic protein 6)	EBI-7043141	0.35
P32835	GTP-binding nuclear protein GSP1/CNR1 (Chromosome stability protein 17) (GTPase Ran homolog) (Genetic suppressor of PRP20-1)	EBI-6472517	0.44
P10591	Heat shock protein SSA1 (Heat shock protein YG100)	EBI-6556984	0.35
P38316	Ubiquitin-like protein ATG12 (Autophagy-related protein 12)	EBI-16263556	0.35
Q00776	AP-1 complex subunit mu-1-I (Clathrin assembly protein complex 1 mu-1-I medium chain) (Clathrin coat assembly protein AP54) (Clathrin coat-associated protein AP54) (Golgi adaptor AP-1 54 kDa protein) (HA1 54 kDa subunit) (Mu(1)-adaptin) (Mu1-I-adaptin)	EBI-16263794	0.35
P38153	AP-3 complex subunit mu (AP-3 adaptor complex mu3A subunit) (Adaptor-related protein complex 3 subunit mu) (Mu-adaptin 3A) (Mu3-adaptin)	EBI-16263895	0.35
Q00684	Tyrosine-protein phosphatase CDC14 (EC 3.1.3.48)	EBI-16265633	0.35
P27636	Cell division control protein 15 (EC 2.7.11.1)	EBI-16265722	0.35
P32562	Cell cycle serine/threonine-protein kinase CDC5/MSD2 (EC 2.7.11.21)	EBI-16266124	0.35
P32601	Protein DSS4	EBI-16268457	0.35
P22696	Peptidyl-prolyl cis-trans isomerase ESS1 (PPIase ESS1) (EC 5.2.1.8) (Parvulin ESS1) (Processing/termination factor 1)	EBI-16268890	0.35
P06774	Transcriptional activator HAP2	EBI-16270452	0.35
Q08273	RING-box protein HRT1 (RING-box protein 1) (E3 ubiquitin-protein ligase complex SCF subunit HRT1) (High level expression reduces Ty3 transposition protein 1) (Regulator of cullins protein 1)	EBI-16271112	0.35
P42838	Alkylphosphocholine resistance protein LEM3 (Brefeldin-A sensitivity protein 3) (Ro-sensitive 3)	EBI-16272625	0.35
P23748	M-phase inducer phosphatase (EC 3.1.3.48) (Mitosis initiation protein MIH1) (Mitotic inducer homolog)	EBI-16273845	0.35
Q04149	Crossover junction endonuclease MUS81 (EC 3.1.22.-) (MMS and UV-sensitive protein 81)	EBI-16274423	0.35
P27801	Vacuolar membrane protein PEP3 (Carboxypeptidase Y-deficient protein 3) (Vacuolar morphogenesis protein 8) (Vacuolar protein sorting-associated protein 18) (Vacuolar protein-targeting protein 18)	EBI-16275426	0.35
Q12223	DNA repair protein RAD59	EBI-16278796	0.35
P40348	Replication factor C subunit 2 (Replication factor C2) (Activator 1 41 kDa subunit)	EBI-16279429	0.35
P25343	Reduced viability upon starvation protein 161	EBI-16281060	0.35
P08458	Sporulation-specific protein 1 (EC 2.7.11.1)	EBI-16283853	0.35
P06245	cAMP-dependent protein kinase type 2 (PKA 2) (EC 2.7.11.11)	EBI-16285493	0.35
P33296	Ubiquitin-conjugating enzyme E2 6 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme 6) (Ubiquitin carrier protein UBC6) (Ubiquitin-protein ligase UBC6)	EBI-16286005	0.35
Q06668	Methyltransferase OMS1, mitochondrial (EC 2.1.1.-) (OXA1 multicopy suppressor 1)	EBI-16288187	0.35
P53243	Zinc finger protein YGR067C	EBI-16289027	0.35
P38885	Altered inheritance of mitochondria protein 46, mitochondrial (Found in mitochondrial proteome protein 34)	EBI-16289603	0.35
Q04437	ATP-dependent DNA helicase II subunit 2 (EC 3.6.4.12) (ATP-dependent DNA helicase II subunit Ku80) (High affinity DNA-binding factor subunit 2) (Yeast Ku80)	EBI-16290301	0.35

Cross-References

Database	Links
UNIPROT	P40069 D3DM16
Pfam	PF03810
PROSITE	PS50077 PS50166

Importin subunit beta-4 (Saccharomyces cerevisiae S288C)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (14 interactors)

Interactions with other proteins (199 interactors)

Cross-References

Database

Links

Description

Description