DnaJ-like chaperone JEM1 - Saccharomyces cerevisiae S288C

DnaJ-like chaperone JEM1 (Saccharomyces cerevisiae S288C)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	DnaJ-like chaperone JEM1
Accession Code	P40358
Gene	JEM1
Organism	Saccharomyces cerevisiae S288C (Taxonomy: 559292)
Part of Reference Proteome?	Yes
Sequence (Length: 645)
MILISGYCLLVYSVILPVLISASKLCDLAELQRLNKNLKVDTESLPKYQWIAGQLEQNCMTADPASENMSDVIQLANQIYYKIGLIQLSNDQHLRAINTFEKIVFNETYKGSFGKLAEKRLQELYVDFGM WDKVHQKDDQYAKYLSLNETIRNKISSKDVSVEEDISELLRITPYDVNVLSTHIDVLFHKLAEEIDVSLAAAIILDYETILDKHLASLSIDTRLSIHYVISVLQTFVLNSDASFNIRKCLSIDMDYDKCK KLSLTISKLNKVNPSKRQILDPATYAFENKKFRSWDRIIEFYLKDKKPFITPMKILNKDTNFKNNYFFLEEIIKQLIEDVQLSRPLAKNLFEDPPITDGFVKPKSYYHTDYLVYIDSILCQASSMSPDVK RAKLAAPFCKKSLRHSLTLETWKHYQDAKSEQKPLPETVLSDVWNSNPHLLMYMVNSILNKSRSKPHSQFKKQLYDQINKFFQDNGLSESTNPYVMKNFRLLQKQLQTYKEHKHRNFNQQYFQQQQQQQQ HQRHQAPPAAPNYDPKKDYYKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEAYETLSDDDKRKEYDLSRSNPRRNTFPQGPRQNNMFKNPGSGFPFGNGFKMNFGL

Subcellular Location

Description
Endoplasmic reticulum membrane {Experimental EvidencePubMed:9148890}; Single-pass type IV membrane protein {Experimental EvidencePubMed:9148890}. Nucleus membrane {ECO:0000269\|PubMed:15282802}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Endoplasmic Reticulum (GO:0005783) Endoplasmic Reticulum Membrane (GO:0005789) Nuclear Membrane (GO:0031965) Nuclear Outer Membrane-Endoplasmic Reticulum Membrane Network (GO:0042175)

Biology & Function

Description
Acts as a DnaJ-like chaperone required for nuclear membrane fusion during mating. {Experimental EvidencePubMed:9148890}.
Assigned Ontology terms

Biological Process	Karyogamy Involved In Conjugation With Cellular Fusion (GO:0000742) Protein Folding In Endoplasmic Reticulum (GO:0034975) Ubiquitin-Dependent ERAD Pathway (GO:0030433)
Molecular Function	Chaperone Binding (GO:0051087) Misfolded Protein Binding (GO:0051787) Unfolded Protein Binding (GO:0051082)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (5 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P32499	Nucleoporin NUP2	EBI-3657516	0.35
P38181	Nucleoporin NUP170	EBI-3657508	0.35
P39685	Nucleoporin POM152	EBI-3657572	0.35
P39705	Nucleoporin NUP60	EBI-3657524	0.35
P47069	Spindle pole body assembly component MPS3	EBI-1560984	0.51
Interactions with other proteins (89 interactors)

Partner (UniProt)		IntAct	Confidence score
P80210	Adenylosuccinate synthetase (AMPSase) (AS-synthetase) (AdSS) (EC 6.3.4.4) (IMP--aspartate ligase)	EBI-3657180	0.35
P38009	Bifunctional purine biosynthesis protein ADE17 [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (ATIC) (IMP synthase) (Inosinicase)]	EBI-3657188	0.35
P53730	Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase (EC 2.4.1.260) (Asparagine-linked glycosylation protein 12) (Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase) (Extracellular mutant protein 39) (Mannosyltransferase ALG12)	EBI-3657196	0.35
P36000	AP-1 complex subunit beta-1 (Beta-1-adaptin) (Clathrin assembly protein complex 1 beta-1 large chain) (Clathrin assembly protein large beta-1 chain)	EBI-3657204	0.35
P38328	Actin-related protein 2/3 complex subunit 1 (Arp2/3 complex 41 kDa subunit) (p41-ARC)	EBI-3657212	0.35
Q12386	Actin-like protein ARP8	EBI-3657220	0.35
P32447	Histone chaperone ASF1 (Anti-silencing function protein 1) (yASF1)	EBI-3657228	0.35
P43583	Proteasome activator BLM10 (Bleomycin resistance protein BLM10)	EBI-3657244	0.35
P48361	Activator of SKN7 protein 10 (Regulator of the glycerol channel 2)	EBI-3657236	0.35
P14682	Ubiquitin-conjugating enzyme E2-34 kDa (EC 2.3.2.23) (Cell division control protein 34) (E2 ubiquitin-conjugating enzyme 3) (E3 ubiquitin ligase complex SCF subunit CDC34) (Ubiquitin carrier protein) (Ubiquitin-protein ligase)	EBI-3657252	0.35
P53622	Coatomer subunit alpha (Alpha-coat protein) (Alpha-COP) (Retrieval from endoplasmic reticulum protein 1) (Secretory protein 22) (Suppressor of osmo-sensitivity 1)	EBI-3657260	0.35
P53859	Exosome complex component CSL4 (CEP1 synthetic lethal protein 4)	EBI-3657268	0.35
Q03375	Pre-mRNA-splicing factor CWC21 (Complexed with CEF1 protein 21)	EBI-3657276	0.35
P40487	2-(3-amino-3-carboxypropyl)histidine synthase subunit 1 (EC 2.5.1.108) (Diphthamide biosynthesis protein 1) (Diphtheria toxin resistance protein 1) (S-adenosyl-L-methionine:L-histidine 3-amino-3-carboxypropyltransferase 1)	EBI-3657292	0.35
P32898	Mitochondrial presequence protease (EC 3.4.24.-) (Cytosolic metalloprotease 1) (Metalloprotease of 112 kDa)	EBI-3657284	0.35
P32461	2-(3-amino-3-carboxypropyl)histidine synthase subunit 2 (Diphthamide biosynthesis protein 2) (Diphtheria toxin resistance protein 2) (S-adenosyl-L-methionine:L-histidine 3-amino-3-carboxypropyltransferase 2)	EBI-3657300	0.35
P40557	ER-retained PMA1-suppressing protein 1 (EC 5.3.4.1)	EBI-3657308	0.35
P53743	Pre-rRNA-processing protein ESF2 (18S rRNA factor 2)	EBI-3657316	0.35
P53849	Zinc finger protein GIS2	EBI-3657332	0.35
P25569	Glucose-induced degradation protein 7	EBI-3657324	0.35
P20448	ATP-dependent RNA helicase HCA4 (EC 3.6.4.13) (DEAD box protein 4) (Helicase CA4) (Helicase UF1)	EBI-3657340	0.35
P61830	Histone H3	EBI-3657348	0.35
P00815	Histidine biosynthesis trifunctional protein [Includes: Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19); Phosphoribosyl-ATP pyrophosphohydrolase (EC 3.6.1.31); Histidinol dehydrogenase (HDH) (EC 1.1.1.23)]	EBI-3657356	0.35
P17629	THO complex subunit HPR1 (Hyperrecombination protein 1)	EBI-3657364	0.35
Q06706	Elongator complex protein 1 (Gamma-toxin target 1) (Protein IKI3)	EBI-3657372	0.35
P50094	Inosine-5'-monophosphate dehydrogenase 4 (IMP dehydrogenase 4) (IMPD 4) (IMPDH 4) (EC 1.1.1.205)	EBI-3657380	0.35
P25642	54S ribosomal protein IMG2, mitochondrial (Integrity of mitochondrial genome protein 2) (Mitochondrial large ribosomal subunit protein mL49)	EBI-3657388	0.35
P40089	U6 snRNA-associated Sm-like protein LSm5	EBI-3657404	0.35
P40070	U6 snRNA-associated Sm-like protein LSm4 (Like-SM protein 4)	EBI-3657396	0.35
P35192	Metal-binding activator 1	EBI-3657412	0.35
Q12387	N-terminal acetyltransferase B complex subunit MDM20 (NatB complex subunit MDM20) (Dislikes extra CIN8 protein 1) (Mitochondrial distribution and morphology protein 20)	EBI-3657420	0.35
P46151	Methylenetetrahydrofolate reductase 1 (EC 1.5.1.20)	EBI-3657428	0.35
P33441	THO complex subunit MFT1 (Mitochondrial fusion target protein 1)	EBI-3657436	0.35
P09440	C-1-tetrahydrofolate synthase, mitochondrial (C1-THF synthase) [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9); Formyltetrahydrofolate synthetase (EC 6.3.4.3)]	EBI-3657444	0.35
Q00539	Protein NAM8 (Nuclear accommodation of mitochondria protein 8) (U1 snRNP component NAM8)	EBI-3657452	0.35
P12945	N-terminal acetyltransferase A complex subunit NAT1 (NatA complex subunit NAT1) (Amino-terminal, alpha-amino, acetyltransferase 1)	EBI-3657460	0.35
Q07896	Nucleolar complex-associated protein 3	EBI-3657468	0.35
P53742	Nucleolar GTP-binding protein 2	EBI-3657476	0.35
Q12499	Nucleolar protein 58 (Nucleolar protein 5)	EBI-3657484	0.35
P53261	Pescadillo homolog (Nucleolar protein 7) (Ribosomal RNA-processing protein 13)	EBI-3657492	0.35
Q01560	Serine/arginine (SR)-type shuttling mRNA binding protein NPL3 (Mitochondrial targeting suppressor 1 protein) (Nuclear polyadenylated RNA-binding protein 1) (Nuclear protein localization protein 3) (Polyadenylate-binding protein NPL3)	EBI-3657500	0.35
P50874	Origin recognition complex subunit 5 (Origin recognition complex 53 kDa subunit)	EBI-3657532	0.35
P32896	Protein PDC2	EBI-3657540	0.35
P16861	ATP-dependent 6-phosphofructokinase subunit alpha (EC 2.7.1.11) (ATP-dependent 6-phosphofructokinase) (ATP-PFK) (Phosphofructokinase 1) (Phosphohexokinase)	EBI-3657548	0.35
P16862	ATP-dependent 6-phosphofructokinase subunit beta (EC 2.7.1.11) (ATP-dependent 6-phosphofructokinase) (ATP-PFK) (Phosphofructokinase 2) (Phosphohexokinase)	EBI-3657556	0.35
P00560	Phosphoglycerate kinase (EC 2.7.2.3)	EBI-3657564	0.35
P32345	Serine/threonine-protein phosphatase 4 catalytic subunit (PP4C) (EC 3.1.3.16) (Phosphatase PP2A-like catalytic subunit PPH3)	EBI-3657580	0.35
P32263	Pyrroline-5-carboxylate reductase (P5C reductase) (P5CR) (EC 1.5.1.2)	EBI-3657588	0.35
Q12417	Pre-mRNA-splicing factor PRP46 (Complexed with CEF1 protein 1) (PRP nineteen-associated complex protein 50) (PRP19-associated complex protein 50) (Pre-mRNA-processing protein 46)	EBI-3657596	0.35
P40164	Serine/threonine-protein phosphatase 4 regulatory subunit 3 (PP4R3)	EBI-3657604	0.35
P06777	DNA repair protein RAD1	EBI-3657612	0.35
Q04231	DNA repair protein RAD33	EBI-3657620	0.35
P12753	DNA repair protein RAD50 (EC 3.6.-.-) (153 kDa protein)	EBI-3657628	0.35
P22336	Replication factor A protein 1 (RF-A protein 1) (DNA-binding protein BUF2) (Replication protein A 69 kDa DNA-binding subunit) (Single-stranded DNA-binding protein)	EBI-3657636	0.35
P26754	Replication factor A protein 2 (RF-A protein 2) (DNA-binding protein BUF1) (Replication protein A 36 kDa subunit)	EBI-3657644	0.35
P21524	Ribonucleoside-diphosphate reductase large chain 1 (EC 1.17.4.1) (Ribonucleotide reductase R1 subunit 1) (Ribonucleotide reductase large subunit 1)	EBI-3657652	0.35
P27999	DNA-directed RNA polymerase II subunit RPB9 (RNA polymerase II subunit B9) (B12.6) (DNA-directed RNA polymerase II 14.2 kDa polypeptide) (DNA-directed RNA polymerase II subunit 9)	EBI-3657660	0.35
P07703	DNA-directed RNA polymerases I and III subunit RPAC1 (RNA polymerases I and III subunit AC1) (C37) (DNA-directed RNA polymerases I and III 40 kDa polypeptide) (AC40) (C40)	EBI-3657668	0.35
P17079	60S ribosomal protein L12-A (L15) (Large ribosomal subunit protein uL11-A) (YL23)	EBI-3657676	0.35
P38764	26S proteasome regulatory subunit RPN1 (HMG-CoA reductase degradation protein 2) (Proteasome non-ATPase subunit 1)	EBI-3657684	0.35
Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	EBI-3657692	0.35
P40856	SIT4-associating protein SAP185	EBI-3657700	0.35
Q12745	Protein transport protein SEC39 (Dependent on SLY1-20 protein 3)	EBI-3657708	0.35
Q03067	SAGA-associated factor 11 (11 kDa SAGA-associated factor)	EBI-3657716	0.35
P39000	Protein SHC1 (Sporulation-specific homolog of CSD4)	EBI-3657724	0.35
Q12460	Nucleolar protein 56 (Ribosome biosynthesis protein SIK1) (Suppressor of I kappa b protein 1)	EBI-3657732	0.35
P17883	Superkiller protein 3	EBI-3657740	0.35
P32908	Structural maintenance of chromosomes protein 1 (DA-box protein SMC1)	EBI-3657748	0.35
P43321	Small nuclear ribonucleoprotein Sm D3 (Sm-D3) (snRNP core protein D3)	EBI-3657756	0.35
P32558	FACT complex subunit SPT16 (Cell division control protein 68) (Facilitates chromatin transcription complex subunit SPT16) (Suppressor of Ty protein 16)	EBI-3657764	0.35
P32585	Mediator of RNA polymerase II transcription subunit 18 (Mediator complex subunit 18) (Suppressor of RNA polymerase B 5)	EBI-3657772	0.35
P36008	Elongation factor 1-gamma 2 (EF-1-gamma 2) (Eukaryotic elongation factor 1Bgamma 2) (eEF1Bgamma 2) (Translation elongation factor 1B gamma 2)	EBI-3657780	0.35
P43637	Serine/threonine-protein kinase TOS3 (EC 2.7.11.1) (Target of SBF protein 3)	EBI-3657788	0.35
P22515	Ubiquitin-activating enzyme E1 1 (EC 6.2.1.45)	EBI-3657796	0.35
P39538	Ubiquitin carboxyl-terminal hydrolase 12 (EC 3.4.19.12) (Deubiquitinating enzyme 12) (Ubiquitin thioesterase 12) (Ubiquitin-specific-processing protease 12)	EBI-3657804	0.35
P50101	Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.4.19.12) (Deubiquitinating enzyme 15) (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15)	EBI-3657812	0.35
P54860	E4 ubiquitin-protein ligase UFD2 (EC 2.3.2.27) (RING-type E3 ubiquitin transferase UFD2) (Ubiquitin conjugation factor E4) (Ubiquitin fusion degradation protein 2) (UB fusion protein 2)	EBI-3657820	0.35
P32861	UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (UDP-glucose pyrophosphorylase) (UDPGP) (UGPase)	EBI-3657828	0.35
P39735	Single-strand annealing weakened protein 1	EBI-3657836	0.35
Q12457	RNA polymerase I termination factor (NTS1 silencing protein 1)	EBI-3657844	0.35
P40521	Putative uncharacterized protein YIL058W	EBI-3657852	0.35
P40566	Ergosteryl-beta-glucosidase (EC 3.2.1.-)	EBI-3657864	0.35
P36076	Coenzyme A biosynthesis protein 3	EBI-3657872	0.35
P38746	Obg-like ATPase homolog (OLA1 homolog)	EBI-3657880	0.35
Q07825	Putative Xaa-Pro aminopeptidase FRA1 (EC 3.4.11.9) (Fe repressor of activation 1)	EBI-3657888	0.35
Q08422	AN1-type zinc finger protein TMC1 (Trivalent metalloid-sensitive Cuz1-related protein 1)	EBI-3657896	0.35
Q12532	Ribosome quality control complex subunit 2 (Translation-associated element 2)	EBI-3657904	0.35
P46951	Cargo-transport protein YPP1 (Alpha-synuclein protective protein 1)	EBI-3657912	0.35
P53900	Prefoldin subunit 4 (Genes involved in microtubule biogenesis protein 3) (Gim complex subunit 3) (GimC subunit 3)	EBI-3657920	0.35

Cross-References

Database	Links
UNIPROT	P40358 D6VWB0
Pfam	PF00226
PROSITE	PS50076

DnaJ-like chaperone JEM1 (Saccharomyces cerevisiae S288C)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (5 interactors)

Interactions with other proteins (89 interactors)

Cross-References

Database

Links

Description

Description