NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Nuclear hormone receptor family member odr-7 - Caenorhabditis elegans - NucEnvDB

Nuclear hormone receptor family member odr-7 (Caenorhabditis elegans)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Nuclear hormone receptor family member odr-7
Accession Code	P41933
Gene	odr
Organism	Caenorhabditis elegans (Taxonomy: 6239)
Part of Reference Proteome?	Yes
Sequence (Length: 457)
MIVPDTEGLLIYSYGLMYGSYCMACQMLIPHFQCIPGIFPNFRISTELIKTMTDKLEQPNNNVPQQPWGPFPPAFGGRPSGEQTDGNPGEFDNDAAHQQTAPFMTHFFPRIGLQFPDFTEYQRFNGFQRN AFFPNPFGSQFTGQAFAQSFPLHNSMTTMDGFNLTHAPHPFSTNTNSTKPKDIENTVQSTIKHSSENIQDKPPVLSVEYPVKYDSELKFDANVDFTAVPKQESSDDSTLKNLKKSDQQLQQPQQFTFPPP LLAEKSFEQPRMREDVLPFHPQFYPAPLDMGTNFKQEMRTPPIDGHIDYRKFDASGKRMEFQPPGALHDCQVCLSTHANGLHFGARTCAACAAFFRRTISDDKRYVCKRNQRCNNASRDGTGYRKICRSC RMKRCLEIGMLPENVQHKRNRRDSGSPPRKTPFDTFFNGFYPSFQPSGSAAQPITVSSSESPRHTTN

Subcellular Location

Description
Nucleus. Cytoplasm, perinuclear region.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Required for the function of one pair of chemosensory neurons called AWA neurons that are involved in chemotaxis to volatile odorants. Acts in a pathway that specifies olfactory neuronal fate. Regulates the transcription of olfactory signaling molecules such as odr-10 that specify AWA neuron identity and function. Represses the expression in AWA neurons of factors such as str-2 which specify AWC neuron identity. {Experimental EvidencePubMed:10421632, Experimental EvidencePubMed:11018015, Experimental EvidencePubMed:11546744, Experimental EvidencePubMed:14704165, Experimental EvidencePubMed:8601313}.
Assigned Ontology terms

Biological Process	Negative Adaptation Of Signaling Pathway (GO:0022401) Positive Chemotaxis (GO:0050918) Positive Regulation Of Transcription By RNA Polymerase II (GO:0045944) Regulation Of Transcription By RNA Polymerase II (GO:0006357) Sensory Perception Of Smell (GO:0007608)
Molecular Function	DNA-Binding Transcription Activator Activity, RNA Polymerase II-Specific (GO:0001228) DNA-Binding Transcription Factor Activity (GO:0003700) Sequence-Specific DNA Binding (GO:0043565) Zinc Ion Binding (GO:0008270)

Protein-Protein Interactions

Interactions with other proteins (6 interactors)

Partner (UniProt)		IntAct	Confidence score
G5EFI7	Myelin regulatory factor homolog 1 (EC 3.4.-.-) (Polyglutamine-repeat protein 47) [Cleaved into: Myelin regulatory factor homolog 1, N-terminal; Myelin regulatory factor homolog 1, C-terminal]	EBI-6731847	0.00
O45291	Putative T-box protein 33	EBI-6736675	0.00
Q19418	Zinc finger protein ztf-2	EBI-6740943	0.00
Q22289	T-box transcription factor tbx-9	EBI-6740956	0.00
Q9NAE4	BZIP domain-containing protein	EBI-6740969	0.00
Q9TXN8	DM (Doublesex/MAB-3) Domain family	EBI-6740982	0.00

Cross-References

Database	Links
UNIPROT	P41933 C3U4U8 C3U4U9 C3U4V2
Pfam	PF00105
PROSITE	PS00031 PS51030

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK