NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Fragile X messenger ribonucleoprotein 1 homolog A - Xenopus laevis - NucEnvDB

Fragile X messenger ribonucleoprotein 1 homolog A (Xenopus laevis)

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

General Information

Protein Information
Protein Name	Fragile X messenger ribonucleoprotein 1 homolog A
Accession Code	P51113
Gene	fmr1
Organism	Xenopus laevis \| African clawed frog (Taxonomy: 8355)
Part of Reference Proteome?	Yes
Sequence (Length: 564)
MEELAVEVRGSNGAFYKAFMKDVHEDSITVTFENNWQQERQIPFHDVRFPPPSGYNKDINERDEVEVYSRANEKEPCCWWLAKVRMIKGEFYVIEYAACDATYNEIVTIERLRSVNPNKPATKSSFHKVK LDVPEDLRQMCAKDSAHKDFKKAVGAFSVSYDSENYQLVILSVNEVSIKRASMLSDMHFRSLRTKLSLMLRNEEASKQLESSRQLASRFHEQFIVREDLMGLAIGTHGANIQQARKVPGVTAIDLDEDTC TFHIYGEDQEAVKKARTYLEFAENVIQVPRNLVGKVIGKNGKLIQEIVDKSGVVRVRIEAENDKNISQEEGIVPFVFVGTKDSITNATVLLDYHLNYLKEVDQLRLERLQIDEQLRHIGASSRPPPNRPD KEKGYLSEDCSGTVRGSRPYSNRGRSRRGTGYASGTNSEASNASETESDHRDELSDWSLAPAEDDRDNYHRRGDGRRRGGTRGQGMRGRGGFKGNDDQPRPDNRQRNSRETKARTSDGSLQIRLDCNNER SVHTKTLQNASVDGSRLRTGKDRVQKKEKTDGVDGPQVVVNGVP

Subcellular Location

Description
Nucleus {By SimilarityUniProtKB:Q06787}. Nucleus, nucleolus {By SimilarityUniProtKB:Q06787}. Chromosome, centromere {ECO:0000250\|UniProtKB:P35922}. Chromosome {ECO:0000250\|UniProtKB:P35922}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:Q06787}. Cytoplasm, Cytoplasmic ribonucleoprotein granule {By SimilarityUniProtKB:Q06787}. Cytoplasm, Stress granule {By SimilarityUniProtKB:Q06787}. Perikaryon {By SimilarityUniProtKB:Q06787}. Cell projection, neuron projection {By SimilarityUniProtKB:Q06787}. Cell projection, axon {ECO:0000250\|UniProtKB:P35922}. Cell projection, dendrite {ECO:0000250\|UniProtKB:P35922}. Cell projection, dendritic spine {ECO:0000250\|UniProtKB:P35922}. Synapse, synaptosome {ECO:0000250\|UniProtKB:P35922}. Cell projection, growth cone {By SimilarityUniProtKB:Q06787}. Cell projection, filopodium tip {ECO:0000250\|UniProtKB:P35922}. Synapse {ECO:0000250\|UniProtKB:P35922}. Postsynaptic cell membrane {ECO:0000250\|UniProtKB:P35922}. Presynaptic cell membrane {ECO:0000250\|UniProtKB:P35922}. Cell membrane {ECO:0000250\|UniProtKB:P35922}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Anchoring Junction (GO:0070161) Axon (GO:0030424) Axon Terminus (GO:0043679) Cell Projection (GO:0042995) Chromocenter (GO:0010369) Chromosome (GO:0005694) Chromosome, Centromeric Region (GO:0000775) Cytoplasm (GO:0005737) Cytoplasmic Ribonucleoprotein Granule (GO:0036464) Cytoplasmic Stress Granule (GO:0010494) Dendrite (GO:0030425) Dendritic Filopodium (GO:1902737) Dendritic Spine (GO:0043197) Extrinsic Component Of Plasma Membrane (GO:0019897) Filopodium Tip (GO:0032433) Glial Cell Projection (GO:0097386) Growth Cone (GO:0030426) Growth Cone Filopodium (GO:1990812) Neuron Projection (GO:0043005) Neuronal Ribonucleoprotein Granule (GO:0071598) Nucleolus (GO:0005730) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perikaryon (GO:0043204) Perinuclear Region Of Cytoplasm (GO:0048471) Polysome (GO:0005844) Postsynapse (GO:0098794) Postsynaptic Density (GO:0014069) Postsynaptic Membrane (GO:0045211) Presynapse (GO:0098793) Presynaptic Membrane (GO:0042734) Ribonucleoprotein Complex (GO:1990904) Synapse (GO:0045202)

Biology & Function

Description
Multifunctional polyribosome-associated RNA-binding protein that plays a central role in neuronal development and synaptic plasticity through the regulation of alternative mRNA splicing, mRNA stability, mRNA dendritic transport and postsynaptic local protein synthesis of a subset of mRNAs (By similarity). Binds poly(G) and poly(U), and to a lower extent poly(A) and poly(C). {By SimilarityUniProtKB:P35922, By SimilarityUniProtKB:Q06787, By SimilarityUniProtKB:Q80WE1, Experimental EvidencePubMed:7781595}.
Assigned Ontology terms

Biological Process	DNA Repair (GO:0006281) Glutamate Receptor Signaling Pathway (GO:0007215) MRNA Processing (GO:0006397) MRNA Transport (GO:0051028) Negative Regulation Of Cytoplasmic Translation (GO:2000766) Negative Regulation Of Gene Expression (GO:0010629) Negative Regulation Of Long-Term Synaptic Depression (GO:1900453) Negative Regulation Of Synaptic Vesicle Exocytosis (GO:2000301) Negative Regulation Of Translation (GO:0017148) Negative Regulation Of Translational Initiation (GO:0045947) Negative Regulation Of Voltage-Gated Calcium Channel Activity (GO:1901386) Nervous System Development (GO:0007399) Positive Regulation Of Dendritic Spine Development (GO:0060999) Positive Regulation Of Filopodium Assembly (GO:0051491) Positive Regulation Of MiRNA-Mediated Gene Silencing (GO:2000637) Positive Regulation Of MRNA Binding (GO:1902416) Positive Regulation Of Proteasomal Protein Catabolic Process (GO:1901800) Positive Regulation Of Receptor Internalization (GO:0002092) Positive Regulation Of Translation (GO:0045727) Regulation Of Alternative MRNA Splicing, Via Spliceosome (GO:0000381) Regulation Of Dendritic Spine Development (GO:0060998) Regulation Of Filopodium Assembly (GO:0051489) Regulation Of MiRNA-Mediated Gene Silencing (GO:0060964) Regulation Of MRNA Stability (GO:0043488) Regulation Of Neuronal Action Potential (GO:0098908) Regulation Of Neurotransmitter Secretion (GO:0046928) RNA Splicing (GO:0008380) Skeletal Muscle Organ Development (GO:0060538)
Molecular Function	Chromatin Binding (GO:0003682) Dynein Complex Binding (GO:0070840) G-Quadruplex RNA Binding (GO:0002151) Methylated Histone Binding (GO:0035064) Microtubule Binding (GO:0008017) MiRNA Binding (GO:0035198) MRNA 3'-UTR Binding (GO:0003730) MRNA 5'-UTR Binding (GO:0048027) MRNA Binding (GO:0003729) Poly(G) Binding (GO:0034046) Poly(U) RNA Binding (GO:0008266) Protein Heterodimerization Activity (GO:0046982) Protein Homodimerization Activity (GO:0042803) RNA Binding (GO:0003723) RNA Stem-Loop Binding (GO:0035613) RNA Strand Annealing Activity (GO:0033592) Sequence-Specific MRNA Binding (GO:1990825) SiRNA Binding (GO:0035197) Translation Repressor Activity (GO:0030371)

Cross-References

Database	Links
UNIPROT	P51113
Pfam	PF05641 PF16098 PF12235 PF00013 PF17904 PF18336
PROSITE	PS51641 PS50084

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK