IST1 homolog - Homo sapiens

IST1 homolog (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	IST1 homolog
Accession Code	P53990
Gene	IST1
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 364)
MLGSGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLLL ARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKI LVERYLIEIAKNYNVPYEPDSVVMAEAPPGVETDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPDGTVPMPMPMPMPSAN TPFSYPLPKGPSDFNGLPMGTYQAFPNIHPPQIPATPPSYESVDDINADKNISSAQIVGPGPKPEASAKLPSRPADNYDN FVLPELPSVPDTLPTASAGASTSASEDIDFDDLSRRFEELKKKT

Structure Viewer (PDB: 6TZ5)

Subcellular Location

Description
Cytoplasmic vesicle {Experimental EvidencePubMed:19129479, Experimental EvidencePubMed:19129480}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {Experimental EvidencePubMed:20719964}. Midbody {Experimental EvidencePubMed:20719964}. Nucleus envelope {Experimental EvidencePubMed:26040712, ECO:0000269\|PubMed:28242692}. Note=Localizes to centrosome and midbody of dividing cells (PubMed:19129480, PubMed:19129479, PubMed:20719964). Colocalized with SPART to the ends of Flemming bodies during cytokinesis (PubMed:20719964). Localizes to the reforming nuclear envelope on chromatin disks during late anaphase. {Experimental EvidencePubMed:19129479, Experimental EvidencePubMed:19129480, Experimental EvidencePubMed:20719964, Experimental EvidencePubMed:26040712, ECO:0000269\|PubMed:28242692}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Azurophil Granule Lumen (GO:0035578) Centrosome (GO:0005813) Cytosol (GO:0005829) Endoplasmic Reticulum-Golgi Intermediate Compartment (GO:0005793) Extracellular Exosome (GO:0070062) Extracellular Region (GO:0005576) Flemming Body (GO:0090543) Intracellular Membrane-Bounded Organelle (GO:0043231) Midbody (GO:0030496) Nuclear Envelope (GO:0005635)

Biology & Function

Description
ESCRT-III-like protein involved in cytokinesis, nuclear envelope reassembly and endosomal tubulation (PubMed:19129479, PubMed:26040712, PubMed:28242692). Is required for efficient abscission during cytokinesis (PubMed:19129479). Involved in recruiting VPS4A and/or VPS4B to the midbody of dividing cells (PubMed:19129480, PubMed:19129479). During late anaphase, involved in nuclear envelope reassembly and mitotic spindle disassembly together with the ESCRT-III complex: IST1 acts by mediating the recruitment of SPAST to the nuclear membrane, leading to microtubule severing (PubMed:26040712). Recruited to the reforming nuclear envelope (NE) during anaphase by LEMD2 (PubMed:28242692). Regulates early endosomal tubulation together with the ESCRT-III complex by mediating the recruitment of SPAST (PubMed:23897888). {Experimental EvidencePubMed:19129479, Experimental EvidencePubMed:19129480, Experimental EvidencePubMed:23897888, Experimental EvidencePubMed:26040712, Experimental EvidencePubMed:28242692}.
Assigned Ontology terms

Biological Process	Abscission (GO:0009838) Cell Division (GO:0051301) Collateral Sprouting (GO:0048668) Cytoskeleton-Dependent Cytokinesis (GO:0061640) ESCRT III Complex Disassembly (GO:1904903) Establishment Of Protein Localization (GO:0045184) Multivesicular Body Assembly (GO:0036258) Positive Regulation Of Collateral Sprouting (GO:0048672) Positive Regulation Of Proteolysis (GO:0045862) Protein Localization (GO:0008104) Protein Transport (GO:0015031) Viral Capsid Secondary Envelopment (GO:0046745) Viral Release From Host Cell (GO:0019076)
Molecular Function	Cadherin Binding (GO:0045296) Identical Protein Binding (GO:0042802) MIT Domain Binding (GO:0090541) Protein Domain Specific Binding (GO:0019904) Protein-Containing Complex Binding (GO:0044877)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (5 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q9QYY8	Spastin	EBI-11090422	0.35
Q9UBP0	Spastin	EBI-21757061	0.35
P53990	Self	EBI-15788908	0.52
Q9H444	Charged multivesicular body protein 4b	EBI-11148324	0.35
Q9D8B3	Charged multivesicular body protein 4b	EBI-11052854	0.35
Interactions with other proteins (35 interactors)

Partner (UniProt)		IntAct	Confidence score
P13798	Acylamino-acid-releasing enzyme (AARE) (EC 3.4.19.1) (Acyl-peptide hydrolase) (APH) (Acylaminoacyl-peptidase) (Oxidized protein hydrolase) (OPH)	EBI-760177	0.75
P54253	Ataxin-1 (Spinocerebellar ataxia type 1 protein)	EBI-24534663	0.72
Q7ARD3	Transcriptional regulator	EBI-2866257	0.00
Q9Y6W3	Calpain-7 (EC 3.4.22.-) (PalB homolog) (PalBH)	EBI-8301445	0.68
P38606	V-type proton ATPase catalytic subunit A (V-ATPase subunit A) (EC 7.1.2.2) (V-ATPase 69 kDa subunit) (Vacuolar ATPase isoform VA68) (Vacuolar proton pump subunit alpha)	EBI-4324466	0.35
P19320	Vascular cell adhesion protein 1 (V-CAM 1) (VCAM-1) (INCAM-100) (CD antigen CD106)	EBI-6189915	0.35
Q7Z479	Calpain 7	EBI-10213458	0.56
Q9UMX0	Ubiquilin-1 (Protein linking IAP with cytoskeleton 1) (PLIC-1) (hPLIC-1)	EBI-10213468	0.56
P36895	Bone morphogenetic protein receptor type-1A (BMP type-1A receptor) (BMPR-1A) (EC 2.7.11.30) (Activin receptor-like kinase 3) (ALK-3) (BMP-2/BMP-4 receptor) (Serine/threonine-protein kinase receptor R5) (SKR5) (CD antigen CD292)	EBI-11008521	0.35
Q8BT07	Centrosomal protein of 55 kDa (Cep55)	EBI-11014656	0.35
Q92734	Protein TFG (TRK-fused gene protein)	EBI-11029015	0.35
Q8C5L3	CCR4-NOT transcription complex subunit 2 (CCR4-associated factor 2)	EBI-11029298	0.35
Q9JLQ0	CD2-associated protein (Mesenchyme-to-epithelium transition protein with SH3 domains 1) (METS-1)	EBI-11033702	0.35
O75787	Renin receptor (ATPase H(+)-transporting lysosomal accessory protein 2) (ATPase H(+)-transporting lysosomal-interacting protein 2) (ER-localized type I transmembrane adapter) (Embryonic liver differentiation factor 10) (N14F) (Renin/prorenin receptor) (Vacuolar ATP synthase membrane sector-associated protein M8-9) (ATP6M8-9) (V-ATPase M8.9 subunit) [Cleaved into: Renin receptor N-terminal fragment; Renin receptor C-terminal fragment]	EBI-11037152	0.35
P51148	Ras-related protein Rab-5C (EC 3.6.5.2) (L1880) (RAB5L)	EBI-11046231	0.35
P51149	Ras-related protein Rab-7a (EC 3.6.5.2)	EBI-11050319	0.35
Q3THE2	Myosin regulatory light chain 12B (Myosin regulatory light chain 2-B, smooth muscle isoform) (Myosin regulatory light chain 20 kDa) (MLC20) (Myosin regulatory light chain MRLC2)	EBI-11063194	0.35
Q00610	Clathrin heavy chain 1 (Clathrin heavy chain on chromosome 17) (CLH-17)	EBI-11082478	0.35
Q61187	Tumor susceptibility gene 101 protein (ESCRT-I complex subunit TSG101)	EBI-11090666	0.35
Q6PB44	Tyrosine-protein phosphatase non-receptor type 23 (EC 3.1.3.48)	EBI-11097749	0.35
Q9R0Q3	Transmembrane emp24 domain-containing protein 2 (COPI-coated vesicle membrane protein p24) (Membrane protein p24A) (Sid 394) (p24 family protein beta-1) (p24beta1)	EBI-11111571	0.35
P46467	Vacuolar protein sorting-associated protein 4B (EC 3.6.4.6) (Suppressor of K(+) transport growth defect 1) (Protein SKD1)	EBI-11115954	0.35
Q9Y3E0	Vesicle transport protein GOT1B (Germ cell tumor 2) (Golgi transport 1 homolog B) (Putative NF-kappa-B-activating protein 470) (hGOT1a)	EBI-11161387	0.35
Q9UHD9	Ubiquilin-2 (Chap1) (DSK2 homolog) (Protein linking IAP with cytoskeleton 2) (PLIC-2) (hPLIC-2) (Ubiquitin-like product Chap1/Dsk2)	EBI-24483554	0.56
Q9HD42	Charged multivesicular body protein 1a (Chromatin-modifying protein 1a) (CHMP1a) (Vacuolar protein sorting-associated protein 46-1) (Vps46-1) (hVps46-1)	EBI-25265048	0.56
O95429	BAG family molecular chaperone regulator 4 (BAG-4) (Bcl-2-associated athanogene 4) (Silencer of death domains)	EBI-24532094	0.56
Q96K76	Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.4.19.12) (Deubiquitinating enzyme 47) (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47)	EBI-21756437	0.35
Q9UBP5	Hairy/enhancer-of-split related with YRPW motif protein 2 (Cardiovascular helix-loop-helix factor 1) (hCHF1) (Class B basic helix-loop-helix protein 32) (bHLHb32) (HES-related repressor protein 2) (Hairy and enhancer of split-related protein 2) (HESR-2) (Hairy-related transcription factor 2) (HRT-2) (hHRT2) (Protein gridlock homolog)	EBI-21874302	0.35
Q7LBR1	Charged multivesicular body protein 1b (CHMP1.5) (Chromatin-modifying protein 1b) (CHMP1b) (Vacuolar protein sorting-associated protein 46-2) (Vps46-2) (hVps46-2)	EBI-15788871	0.63
P09622	Dihydrolipoyl dehydrogenase, mitochondrial (EC 1.8.1.4) (Dihydrolipoamide dehydrogenase) (Glycine cleavage system L protein)	EBI-20304669	0.35
Q83D60	Hypothetical cytosolic protein	EBI-21285718	0.37
P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	EBI-21301141	0.35
Q9NRI5	Disrupted in schizophrenia 1 protein	EBI-21393011	0.00
Q5NGE3	Lipoprotein	EBI-22298572	0.37
F1PAA9	Cadherin-1 (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3]	EBI-27079701	0.27

Cross-References

Database	Links
UNIPROT	P53990 A8KAH5 J3QLU7 Q3SYM4 Q9BQ81 Q9BWN2
PDB	3FRR 3FRS 3JC1 4U7E 4U7I 4U7Y 4WZX 6E8G 6TZ4 6TZ5 6TZA
Pfam	PF03398
OMIM	616434
DisGeNET	9798

IST1 homolog (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 6TZ5)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (5 interactors)

Interactions with other proteins (35 interactors)

Cross-References

Database

Links

Description

Description