NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Stathmin-2 - Mus musculus - NucEnvDB

Stathmin-2 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Stathmin-2
Accession Code	P55821
Gene	Stmn2
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 179)
MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEAAEERRKSQEAQVLKQLAEKREHEREVLQKALEENNNFSKM AEEKLILKMEQIKENREANLAAIIERLQEKERHAAEVRRNKELQVELSG

Subcellular Location

Description
Cytoplasm {Experimental EvidencePubMed:16618812}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:16618812}. Cell projection, growth cone {Experimental EvidencePubMed:16618812}. Cell projection, axon {Experimental EvidencePubMed:16618812}. Membrane {ECO:0000305}; Peripheral membrane protein {ECO:0000305}; Cytoplasmic side {ECO:0000305}. Endosome {ECO:0000250}. Golgi apparatus {ECO:0000250}. Cell projection, lamellipodium {ECO:0000250}. Note=Colocalized with CIB1 in neurites of developing hippocampal primary neurons. Colocalized with CIB1 in the cell body, neuritis, growth cones of neurons and in neurites of developing hippocampal primary neurons. Colocalized with CIB1 to the leading edge of lamellipodia (By similarity). Associated with punctate structures in the perinuclear cytoplasm, axons, and growth cones of developing neurons. Exists in both soluble and membrane-bound forms. In the developing brain, mostly cytosolic. {ECO:0000250}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Lipid-Anchored	UniProt	By Similarity {ECO:0000250}
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Endosome (GO:0005768) Golgi Apparatus (GO:0005794) Growth Cone (GO:0030426) Lamellipodium (GO:0030027) Membrane (GO:0016020) Neuron Projection (GO:0043005) Neuronal Cell Body (GO:0043025) Perinuclear Region Of Cytoplasm (GO:0048471) Vesicle (GO:0031982)

Biology & Function

Description
Regulator of microtubule stability. When phosphorylated by MAPK8, stabilizes microtubules and consequently controls neurite length in cortical neurons. In the developing brain, negatively regulates the rate of exit from multipolar stage and retards radial migration from the ventricular zone. {Experimental EvidencePubMed:21297631}.
Assigned Ontology terms

Biological Process	Cellular Response To Nerve Growth Factor Stimulus (GO:1990090) Microtubule Depolymerization (GO:0007019) Negative Regulation Of Microtubule Depolymerization (GO:0007026) Negative Regulation Of Microtubule Polymerization (GO:0031115) Negative Regulation Of Neuron Projection Development (GO:0010977) Neuron Projection Development (GO:0031175) Positive Regulation Of Microtubule Depolymerization (GO:0031117) Positive Regulation Of Neuron Projection Development (GO:0010976) Regulation Of Microtubule Polymerization Or Depolymerization (GO:0031110)
Molecular Function	Calcium-Dependent Protein Binding (GO:0048306) Tubulin Binding (GO:0015631)

Protein-Protein Interactions

Interactions with other proteins (2 interactors)

Partner (UniProt)		IntAct	Confidence score
Q7TQF1	Protocadherin gamma subfamily B, 1	EBI-7412883	0.54
Q9EPL2	Calsyntenin-1 (Alcadein-alpha) (Alc-alpha) [Cleaved into: Soluble Alc-alpha (SAlc-alpha); CTF1-alpha (C-terminal fragment 1-alpha)]	EBI-3869454	0.35

Cross-References

Database	Links
UNIPROT	P55821
Pfam	PF00836
PROSITE	PS00563 PS01041 PS51663

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK