NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Ras-related C3 botulinum toxin substrate 3 - Mus musculus - NucEnvDB

Ras-related C3 botulinum toxin substrate 3 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Ras-related C3 botulinum toxin substrate 3
Accession Code	P60764
Gene	Rac3
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 192)
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLR DKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF

Subcellular Location

Description
Cytoplasm {By SimilarityUniProtKB:P60763}. Endomembrane system {By SimilarityUniProtKB:P60763}. Cell projection, lamellipodium {By SimilarityUniProtKB:P60763}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:P60763}. Cell membrane {By SimilarityUniProtKB:P60763}. Cytoplasm, cytoskeleton {By SimilarityUniProtKB:P60763}. Note=Membrane-associated when activated. Colocalizes with NRBP to endomembranes and at the cell periphery in lamellipodia. Colocalized with CIB1 in the perinuclear area and at the cell periphery. {By SimilarityUniProtKB:P60763}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Lipid-Anchored	UniProt	By Similarity {ECO:0000250}
Assigned Ontology terms

Cellular Component	Cell Cortex (GO:0005938) Cell Periphery (GO:0071944) Cell Projection (GO:0042995) Cytoplasmic Vesicle (GO:0031410) Cytoskeleton (GO:0005856) Cytosol (GO:0005829) Endomembrane System (GO:0012505) Filamentous Actin (GO:0031941) Growth Cone (GO:0030426) Lamellipodium (GO:0030027) Neuron Projection (GO:0043005) Neuronal Cell Body (GO:0043025) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Synapse (GO:0045202)

Biology & Function

Description
Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as cell spreading and the formation of actin-based protusions including lamellipodia and membrane ruffles. Promotes cell adhesion and spreading on fibrinogen in a CIB1 and alpha-IIb/beta3 integrin-mediated manner. {By SimilarityUniProtKB:P60763}.
Assigned Ontology terms

Biological Process	Actin Cytoskeleton Organization (GO:0030036) Actin Filament Organization (GO:0007015) Cell Projection Assembly (GO:0030031) Cerebral Cortex GABAergic Interneuron Development (GO:0021894) Cortical Cytoskeleton Organization (GO:0030865) Establishment Or Maintenance Of Cell Polarity (GO:0007163) Homeostasis Of Number Of Cells Within A Tissue (GO:0048873) Neuromuscular Process (GO:0050905) Neuromuscular Process Controlling Balance (GO:0050885) Neuron Projection Development (GO:0031175) Positive Regulation Of Cell Adhesion Mediated By Integrin (GO:0033630) Positive Regulation Of Substrate Adhesion-Dependent Cell Spreading (GO:1900026) Regulation Of Actin Cytoskeleton Organization (GO:0032956) Regulation Of Cell Morphogenesis (GO:0022604) Regulation Of Cell Shape (GO:0008360) Regulation Of Neuron Maturation (GO:0014041) Small GTPase Mediated Signal Transduction (GO:0007264) Synaptic Transmission, GABAergic (GO:0051932) Wnt Signaling Pathway (GO:0016055)
Molecular Function	Calcium-Dependent Protein Binding (GO:0048306) G Protein Activity (GO:0003925) GTP Binding (GO:0005525) GTPase Activity (GO:0003924) Protein Kinase Binding (GO:0019901)

Protein-Protein Interactions

Interactions with other proteins (4 interactors)

Partner (UniProt)		IntAct	Confidence score
Q60749	KH domain-containing, RNA-binding, signal transduction-associated protein 1 (GAP-associated tyrosine phosphoprotein p62) (Src-associated in mitosis 68 kDa protein) (Sam68) (p21 Ras GTPase-activating protein-associated p62) (p68)	EBI-653444	0.37
Q99PT1	Rho GDP-dissociation inhibitor 1 (Rho GDI 1) (GDI-1) (Rho-GDI alpha)	EBI-653347	0.37
Q61599	Rho GDP-dissociation inhibitor 2 (Rho GDI 2) (D4) (Rho-GDI beta)	EBI-653366	0.37
Q8BIZ1	Ankyrin repeat and sterile alpha motif domain-containing protein 1B (Amyloid-beta protein intracellular domain-associated protein 1) (AIDA-1) (E2A-PBX1-associated protein) (EB-1)	EBI-26595802	0.35

Cross-References

Database	Links
UNIPROT	P60764 O14658
Pfam	PF00071
PROSITE	PS51420

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK