NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Synaptosomal-associated protein 25 - Macaca mulatta - NucEnvDB

Synaptosomal-associated protein 25 (Macaca mulatta)

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

General Information

Protein Information
Protein Name	Synaptosomal-associated protein 25
Accession Code	P60877
Gene	SNAP25
Organism	Macaca mulatta \| Rhesus monkey (Taxonomy: 9544)
Part of Reference Proteome?	Yes
Sequence (Length: 206)
MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAIS GGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG

Subcellular Location

Description
Cytoplasm, perinuclear region {By SimilarityUniProtKB:P60879}. Cell membrane {By SimilarityUniProtKB:P60881}; Lipid-anchor {By SimilarityUniProtKB:P60879}. Synapse, synaptosome {By SimilarityUniProtKB:P60879}. Photoreceptor inner segment {By SimilarityUniProtKB:P60879}. Note=Membrane association requires palmitoylation. Expressed throughout cytoplasm, concentrating at the perinuclear region. Colocalizes with KCNB1 at the cell membrane (By similarity). Colocalizes with PLCL1 at the cell membrane (By similarity). {By SimilarityUniProtKB:P60879, By SimilarityUniProtKB:P60881}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Lipid-Anchored	UniProt	By Similarity {ECO:0000250\|UniProtKB:P60879}
Assigned Ontology terms

Cellular Component	Anchoring Junction (GO:0070161) Axon (GO:0030424) BLOC-1 Complex (GO:0031083) Cytoplasm (GO:0005737) Cytoskeleton (GO:0005856) Extrinsic Component Of Cytoplasmic Side Of Plasma Membrane (GO:0031234) Glutamatergic Synapse (GO:0098978) Membrane (GO:0016020) Perinuclear Region Of Cytoplasm (GO:0048471) Photoreceptor Inner Segment (GO:0001917) Plasma Membrane (GO:0005886) Postsynapse (GO:0098794) Presynaptic Membrane (GO:0042734) Ribbon Synapse (GO:0097470) SNARE Complex (GO:0031201) Somatodendritic Compartment (GO:0036477) Synaptic Vesicle (GO:0008021) Synaptobrevin 2-SNAP-25-Syntaxin-1a-Complexin I Complex (GO:0070032) Trans-Golgi Network (GO:0005802)

Biology & Function

Description
t-SNARE involved in the molecular regulation of neurotransmitter release. May play an important role in the synaptic function of specific neuronal systems. Associates with proteins involved in vesicle docking and membrane fusion. Regulates plasma membrane recycling through its interaction with CENPF. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1 in pancreatic beta cells. {By SimilarityUniProtKB:P60881}.
Assigned Ontology terms

Biological Process	Associative Learning (GO:0008306) Exocytic Insertion Of Neurotransmitter Receptor To Postsynaptic Membrane (GO:0098967) Exocytosis (GO:0006887) Locomotory Behavior (GO:0007626) Long-Term Synaptic Potentiation (GO:0060291) Neurotransmitter Receptor Internalization (GO:0099590) Regulation Of Establishment Of Protein Localization (GO:0070201) Regulation Of Neuron Projection Development (GO:0010975) Synaptic Vesicle Fusion To Presynaptic Active Zone Membrane (GO:0031629) Synaptic Vesicle Priming (GO:0016082) Vesicle Fusion (GO:0006906)
Molecular Function	SNAP Receptor Activity (GO:0005484) Syntaxin Binding (GO:0019905) Syntaxin-1 Binding (GO:0017075) Voltage-Gated Potassium Channel Activity (GO:0005249)

Cross-References

Database	Links
UNIPROT	P60877 P13795 P36974 P70557 P70558 Q8IXK3 Q96FM2 Q9BR45
Pfam	PF00835
PROSITE	PS50192

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK