NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Cyclin-dependent kinase 5 activator 1, p25 - Mus musculus - NucEnvDB

Cyclin-dependent kinase 5 activator 1, p25 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Cyclin-dependent kinase 5 activator 1, p25
Accession Code	P61809
Gene	Cdk5r1
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 307)
MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKAQPNSSYQSNIAHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGVSSSVKKAPH PAITSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDR CLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR

Subcellular Location

Description
[Cyclin-dependent kinase 5 activator 1, p35]: Cell membrane {By SimilarityUniProtKB:Q15078}; Lipid-anchor {By SimilarityUniProtKB:Q15078}; Cytoplasmic side {By SimilarityUniProtKB:Q15078}. Cell projection, neuron projection {By SimilarityUniProtKB:Q15078}. Note=In the primary cortical neurons, p35 is present in the peripheries and nerve terminals. {By SimilarityUniProtKB:Q15078}. [Cyclin-dependent kinase 5 activator 1, p25]: Nucleus {By SimilarityUniProtKB:Q15078}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:Q15078}. Perikaryon {By SimilarityUniProtKB:Q15078}. Note=The conversion of p35 to p25 relocalizes the protein from the cell periphery to the cytoplasm, in nuclear and perinuclear regions. In the primary cortical neurons, p25 is primarily concentrated in the cell soma and is largely absent from neurites. {By SimilarityUniProtKB:Q15078}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Lipid-Anchored	UniProt	By Similarity {ECO:0000250}
Assigned Ontology terms

Cellular Component	Axon (GO:0030424) Contractile Fiber (GO:0043292) Cyclin-Dependent Protein Kinase Holoenzyme Complex (GO:0000307) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Dendrite (GO:0030425) Dendritic Spine (GO:0043197) Growth Cone (GO:0030426) Intracellular Membrane-Bounded Organelle (GO:0043231) Membrane (GO:0016020) Neuromuscular Junction (GO:0031594) Neuronal Cell Body (GO:0043025) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perikaryon (GO:0043204) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Postsynaptic Density (GO:0014069) Presynapse (GO:0098793) Protein Kinase 5 Complex (GO:0016533)

Biology & Function

Description
p35 is a neuron specific activator of CDK5. The complex p35/CDK5 is required for neurite outgrowth and cortical lamination. Involved in dendritic spine morphogenesis by mediating the EFNA1-EPHA4 signaling. Activator of TPKII. The complex p35/CDK5 participates in the regulation of the circadian clock by modulating the function of CLOCK protein: phosphorylates CLOCK at 'Thr-451' and 'Thr-461' and regulates the transcriptional activity of the CLOCK-ARNTL/BMAL1 heterodimer in association with altered stability and subcellular distribution. {Experimental EvidencePubMed:17143272, Experimental EvidencePubMed:24235147}.
Assigned Ontology terms

Biological Process	Axon Guidance (GO:0007411) Axonal Fasciculation (GO:0007413) Brain Development (GO:0007420) Cerebellum Development (GO:0021549) Cerebral Cortex Radially Oriented Cell Migration (GO:0021799) Embryo Development Ending In Birth Or Egg Hatching (GO:0009792) Ephrin Receptor Signaling Pathway (GO:0048013) G Protein-Coupled Acetylcholine Receptor Signaling Pathway (GO:0007213) G1 To G0 Transition Involved In Cell Differentiation (GO:0070315) Hippocampus Development (GO:0021766) Ionotropic Glutamate Receptor Signaling Pathway (GO:0035235) Layer Formation In Cerebral Cortex (GO:0021819) Negative Regulation Of DNA-Templated Transcription (GO:0045892) Neuron Cell-Cell Adhesion (GO:0007158) Neuron Differentiation (GO:0030182) Neuron Migration (GO:0001764) Neuron Projection Development (GO:0031175) Peptidyl-Serine Phosphorylation (GO:0018105) Peptidyl-Threonine Phosphorylation (GO:0018107) Positive Regulation Of MHC Class II Biosynthetic Process (GO:0045348) Positive Regulation Of Neuron Apoptotic Process (GO:0043525) Positive Regulation Of Protein Kinase Activity (GO:0045860) Positive Regulation Of Protein Targeting To Membrane (GO:0090314) Positive Regulation Of Signaling Receptor Activity (GO:2000273) Regulation Of Actin Cytoskeleton Organization (GO:0032956) Regulation Of Dendritic Spine Morphogenesis (GO:0061001) Regulation Of Microtubule Cytoskeleton Organization (GO:0070507) Regulation Of Synaptic Vesicle Cycle (GO:0098693) Rhythmic Process (GO:0048511) Serine Phosphorylation Of STAT Protein (GO:0042501) Superior Olivary Nucleus Maturation (GO:0021722)
Molecular Function	Actin Binding (GO:0003779) Actin Filament Binding (GO:0051015) Cadherin Binding (GO:0045296) Calcium Ion Binding (GO:0005509) Cyclin-Dependent Protein Serine/Threonine Kinase Activator Activity (GO:0061575) Cytoskeletal Protein Binding (GO:0008092) Ephrin Receptor Binding (GO:0046875) Hsp90 Protein Binding (GO:0051879) Ionotropic Glutamate Receptor Binding (GO:0035255) Kinase Activity (GO:0016301) Protease Binding (GO:0002020) Protein Kinase Binding (GO:0019901) Protein Serine/Threonine Kinase Activator Activity (GO:0043539)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P15209	BDNF/NT-3 growth factors receptor	EBI-15624695	0.35
Interactions with other proteins (6 interactors)

Partner (UniProt)		IntAct	Confidence score
P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3]	EBI-7840493	0.40
P49615	Cyclin-dependent kinase 5 (EC 2.7.11.1) (Cell division protein kinase 5) (Cyclin-dependent-like kinase 5) (Serine/threonine-protein kinase PSSALRE) (Tau protein kinase II catalytic subunit) (TPKII catalytic subunit)	EBI-7840587	0.56
Q8CFH6	Serine/threonine-protein kinase SIK2 (EC 2.7.11.1) (Salt-inducible kinase 2) (SIK-2) (Serine/threonine-protein kinase SNF1-like kinase 2)	EBI-16094166	0.54
O43164	E3 ubiquitin-protein ligase Praja-2 (Praja2) (EC 2.3.2.27) (RING finger protein 131) (RING-type E3 ubiquitin transferase Praja-2)	EBI-16094147	0.40
P62991	Ubiquitin-40S ribosomal protein S27a (Ubiquitin carboxyl extension protein 80) [Cleaved into: Ubiquitin; 40S ribosomal protein S27a]	EBI-16094258	0.40
Q80U04	E3 ubiquitin-protein ligase Praja-2 (Praja2) (EC 2.3.2.27) (RING finger protein 131) (RING-type E3 ubiquitin transferase Praja-2)	EBI-16094239	0.52

Cross-References

Database	Links
UNIPROT	P61809 Q62938
Pfam	PF03261

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK