NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Myotrophin - Mus musculus - NucEnvDB

Myotrophin (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Myotrophin
Accession Code	P62774
Gene	Mtpn
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 118)
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGH VSCVKLLLSKGADKTVKGPDGLTALEATDNQAIKALLQ

Structure Viewer (PDB: 2KXP)

Subcellular Location

Description
Cytoplasm {Curator Inference}. Nucleus {By Similarity}. Cytoplasm, perinuclear region {By Similarity}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Axon (GO:0030424) Cytoplasm (GO:0005737) Cytosol (GO:0005829) F-Actin Capping Protein Complex (GO:0008290) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Promotes dimerization of NF-kappa-B subunits and regulates NF-kappa-B transcription factor activity. Promotes growth of cardiomyocytes, but not cardiomyocyte proliferation. Promotes cardiac muscle hypertrophy (By similarity). Plays a role in the regulation of the growth of actin filaments. Inhibits the activity of the F-actin- capping protein complex formed by the CAPZA1 and CAPZB heterodimer. {By Similarity, Experimental EvidencePubMed:20538588}.
Assigned Ontology terms

Biological Process	Catecholamine Metabolic Process (GO:0006584) Cellular Response To Mechanical Stimulus (GO:0071260) Cerebellar Granule Cell Differentiation (GO:0021707) Positive Regulation Of Cardiac Muscle Hypertrophy (GO:0010613) Positive Regulation Of Cell Growth (GO:0030307) Positive Regulation Of Macromolecule Biosynthetic Process (GO:0010557) Positive Regulation Of NF-KappaB Transcription Factor Activity (GO:0051092) Positive Regulation Of Protein Metabolic Process (GO:0051247) Regulation Of Barbed-End Actin Filament Capping (GO:2000812) Regulation Of Cell Size (GO:0008361) Skeletal Muscle Tissue Regeneration (GO:0043403) Striated Muscle Cell Differentiation (GO:0051146)
Molecular Function	Sequence-Specific DNA Binding (GO:0043565)

Protein-Protein Interactions

Interactions with other proteins (1 interactors)

Partner (UniProt)		IntAct	Confidence score
Q62108	Disks large homolog 4 (Postsynaptic density protein 95) (PSD-95) (Synapse-associated protein 90) (SAP-90) (SAP90)	EBI-2307988	0.35

Cross-References

Database	Links
UNIPROT	P62774 P80144 Q543M6 Q9DCN8
PDB	2KXP
Pfam	PF12796
PROSITE	PS50297 PS50088

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK