NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 - Mus musculus - NucEnvDB

Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Accession Code	P62880
Gene	Gnb2
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 340)
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTRE GNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQE LLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN

Subcellular Location

Description
Cytoplasm, perinuclear region {By SimilarityUniProtKB:P62879}. Cell membrane {By SimilarityUniProtKB:P62879}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cell Body (GO:0044297) Cytoplasm (GO:0005737) Heterotrimeric G-Protein Complex (GO:0005834) Myelin Sheath (GO:0043209) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Protein-Containing Complex (GO:0032991)

Biology & Function

Description
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
Assigned Ontology terms

Biological Process	G Protein-Coupled Receptor Signaling Pathway (GO:0007186) Regulation Of Potassium Ion Transmembrane Transport (GO:1901379)
Molecular Function	Calcium Channel Regulator Activity (GO:0005246) GTPase Activity (GO:0003924) GTPase Binding (GO:0051020) Protein-Containing Complex Binding (GO:0044877) Signaling Receptor Complex Adaptor Activity (GO:0030159)

Protein-Protein Interactions

Interactions with other proteins (9 interactors)

Partner (UniProt)		IntAct	Confidence score
P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	EBI-2933536	0.35
Q92556	Engulfment and cell motility protein 1 (Protein ced-12 homolog)	EBI-8764414	0.40
P42858	Huntingtin (Huntington disease protein) (HD protein) [Cleaved into: Huntingtin, myristoylated N-terminal fragment]	EBI-9072041	0.35
Q3U1F9	Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 (Csk-binding protein) (Transmembrane phosphoprotein Cbp)	EBI-12603102	0.35
P22682	E3 ubiquitin-protein ligase CBL (EC 2.3.2.27) (Casitas B-lineage lymphoma proto-oncogene) (Proto-oncogene c-Cbl) (RING-type E3 ubiquitin transferase CBL) (Signal transduction protein CBL)	EBI-12600757	0.35
Q9D415	Disks large-associated protein 1 (DAP-1) (Guanylate kinase-associated protein) (PSD-95/SAP90-binding protein 1) (SAP90/PSD-95-associated protein 1) (SAPAP1)	EBI-16725590	0.35
Q3UHD9	Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 (AGAP-2) (Centaurin-gamma-1) (Cnt-g1) (Phosphatidylinositol 3-kinase enhancer) (PIKE)	EBI-16736255	0.35
Q9NRI5	Disrupted in schizophrenia 1 protein	EBI-26612017	0.35
Q4ACU6	SH3 and multiple ankyrin repeat domains protein 3 (Shank3) (Proline-rich synapse-associated protein 2) (ProSAP2) (SPANK-2)	EBI-26960892	0.35

Cross-References

Database	Links
UNIPROT	P62880 P11016 P54312
Pfam	PF00400
PROSITE	PS00678 PS50082 PS50294

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK