NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

DnaJ homolog subfamily A member 1 - Rattus norvegicus - NucEnvDB

DnaJ homolog subfamily A member 1 (Rattus norvegicus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	DnaJ homolog subfamily A member 1
Accession Code	P63036
Gene	Dnaja1
Organism	Rattus norvegicus \| Norway rat (Taxonomy: 10116)
Part of Reference Proteome?	Yes
Sequence (Length: 397)
MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLADSKKRELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKNVVHQLSVTLEDLYNGATRKLALQK NVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFM CMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQVELVDFDPNQERRRHYNGEAYEDDEHHPRG GVQCQTS

Subcellular Location

Description
Membrane {By Similarity}; Lipid-anchor {By Similarity}. Cytoplasm {ECO:0000269\|PubMed:10816573}. Microsome {ECO:0000269\|PubMed:10816573}. Mitochondrion {ECO:0000269\|PubMed:10816573}. Nucleus {ECO:0000269\|PubMed:10816573}. Cytoplasm, perinuclear region {By Similarity}. Note=Primarily cytoplasmic and associated with microsomes. A minor proportion is associated with nuclei and mitochondria.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Lipid-Anchored	UniProt	By Similarity {ECO:0000250}
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Cytosol (GO:0005829) Endoplasmic Reticulum (GO:0005783) Membrane (GO:0016020) Microtubule Cytoskeleton (GO:0015630) Mitochondrion (GO:0005739) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Functions as co-chaperone for HSPA1B and negatively regulates the translocation of BAX from the cytosol to mitochondria in response to cellular stress, thereby protecting cells against apoptosis. Promotes apoptosis in response to cellular stress mediated by exposure to anisomycin or UV. Stimulates ATP hydrolysis, but not the folding of unfolded proteins mediated by HSPA1A (in vitro) (By similarity). Co- chaperone for HSPA8/Hsc70. Plays a role in protein transport into mitochondria via its role as co-chaperone (PubMed:10816573). {By Similarity, Experimental EvidencePubMed:10816573, Experimental EvidencePubMed:9605323}.
Assigned Ontology terms

Biological Process	Androgen Receptor Signaling Pathway (GO:0030521) Flagellated Sperm Motility (GO:0030317) Negative Regulation Of Apoptotic Process (GO:0043066) Negative Regulation Of Establishment Of Protein Localization To Mitochondrion (GO:1903748) Negative Regulation Of JUN Kinase Activity (GO:0043508) Negative Regulation Of Nitrosative Stress-Induced Intrinsic Apoptotic Signaling Pathway (GO:1905259) Negative Regulation Of Protein Ubiquitination (GO:0031397) Positive Regulation Of Apoptotic Process (GO:0043065) Protein Localization To Mitochondrion (GO:0070585) Protein Refolding (GO:0042026) Regulation Of Protein Transport (GO:0051223) Response To Heat (GO:0009408) Spermatogenesis (GO:0007283) Toxin Transport (GO:1901998)
Molecular Function	ATP Binding (GO:0005524) ATPase Activator Activity (GO:0001671) C3HC4-Type RING Finger Domain Binding (GO:0055131) Chaperone Binding (GO:0051087) G Protein-Coupled Receptor Binding (GO:0001664) Hsp70 Protein Binding (GO:0030544) Low-Density Lipoprotein Particle Receptor Binding (GO:0050750) Metal Ion Binding (GO:0046872) Tat Protein Binding (GO:0030957) Ubiquitin Protein Ligase Binding (GO:0031625) Unfolded Protein Binding (GO:0051082)

Protein-Protein Interactions

Interactions with other proteins (2 interactors)

Partner (UniProt)		IntAct	Confidence score
P06536	Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1)	EBI-1187343	0.35
P54645	5'-AMP-activated protein kinase catalytic subunit alpha-1 (AMPK subunit alpha-1) (EC 2.7.11.1) (Acetyl-CoA carboxylase kinase) (ACACA kinase) (EC 2.7.11.27) (Hydroxymethylglutaryl-CoA reductase kinase) (HMGCR kinase) (EC 2.7.11.31) (Tau-protein kinase PRKAA1) (EC 2.7.11.26)	EBI-16399805	0.35

Cross-References

Database	Links
UNIPROT	P63036 P54102
Pfam	PF00226 PF01556 PF00684
PROSITE	PS00636 PS50076 PS51188

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK