NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

PDZ and LIM domain protein 4 - Mus musculus - NucEnvDB

PDZ and LIM domain protein 4 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	PDZ and LIM domain protein 4
Accession Code	P70271
Gene	Pdlim4
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 330)
MTHSVTLRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQAINGESTELMTHLEAQNRIKGCHDHLTLSVSRPENKNWPSAPDDKAQAHRIHIDPESQDCSPATSRRSSVSGISLEDNRS GLGSPYGQPPRLPVPHNGSSNEATLPAQMSALHVSPPTSADTARVLPRNRDCRVDLGSEVYRMLREPAEPTASEPKQSGSFRYLQGMLEAGEGGDRPGSGGPRNLKPAASKLGAPLSGLQGLPECTRCGH GIVGTIVKARDKLYHPECFMCSDCGLNLKQRGYFFLDERLYCENHAKARVKPPEGYDVVAVYPNAKVELV

Subcellular Location

Description
Cytoplasm, cytoskeleton {By SimilarityUniProtKB:P36202}. Cell projection, dendritic spine {By SimilarityUniProtKB:P36202}. Early endosome membrane {By SimilarityUniProtKB:P36202}; Peripheral membrane protein {By SimilarityUniProtKB:P36202}; Cytoplasmic side {By SimilarityUniProtKB:P36202}. Recycling endosome membrane {By SimilarityUniProtKB:P36202}; Peripheral membrane protein {By SimilarityUniProtKB:P36202}; Cytoplasmic side {By SimilarityUniProtKB:P36202}. Nucleus {ECO:0000250\|UniProtKB:P50479}. Cytoplasm, perinuclear region {ECO:0000250\|UniProtKB:P50479}. Cell projection, lamellipodium {ECO:0000250\|UniProtKB:P50479}. Synapse, synaptosome {By SimilarityUniProtKB:P36202}. Note=Localizes to actin stress fibers in nonmuscle cells. Colocalizes with GRIA1 in early endosomes. Enriched in numerous but not all spine-like structures along dendritic branches. Colocalizes with actin and enriched at sites containing larger amounts of actin and alpha-actinin. Targeted efficiently to spines via its PDZ domain-mediated interaction with the alpha-actinin/actin cytoskeletal complex. Localizes to synaptosomes in brain (By similarity). Colocalizes with F-actin. Colocalizes with TRIP6 at cell-cell contacts and lamellipodia. In the cytoplasm, displays a fibrillar pattern with characteristic thick fibers and occasional clusters. Colocalizes with the actin stress fibers. Oxidative stress induces redistribution from cytoskeleton to cytosol. Colocalizes with SRC at the perinuclear region, but not at focal adhesions (By similarity). {By SimilarityUniProtKB:P36202, ECO:0000250\|UniProtKB:P50479}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	By Similarity {ECO:0000250\|UniProtKB:P36202}
Assigned Ontology terms

Cellular Component	Actin Cytoskeleton (GO:0015629) Adherens Junction (GO:0005912) Cytoplasm (GO:0005737) Cytoskeleton (GO:0005856) Dendritic Spine (GO:0043197) Early Endosome Lumen (GO:0031905) Early Endosome Membrane (GO:0031901) Filamentous Actin (GO:0031941) Lamellipodium (GO:0030027) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Postsynaptic Membrane (GO:0045211) Recycling Endosome Lumen (GO:0034777) Recycling Endosome Membrane (GO:0055038) Stress Fiber (GO:0001725) Z Disc (GO:0030018)

Biology & Function

Description
Suppresses SRC activation by recognizing and binding to active SRC and facilitating PTPN13-mediated dephosphorylation of SRC 'Tyr-419' leading to its inactivation. Inactivated SRC dissociates from this protein allowing the initiation of a new SRC inactivation cycle. Involved in reorganization of the actin cytoskeleton (By similarity). In nonmuscle cells, binds to ACTN1 (alpha-actinin-1), increases the affinity of ACTN1 to F-actin (filamentous actin), and promotes formation of actin stress fibers. Involved in regulation of the synaptic AMPA receptor transport in dendritic spines of hippocampal pyramidal neurons directing the receptors toward an insertion at the postsynaptic membrane. Links endosomal surface-internalized GRIA1- containing AMPA receptors to the alpha-actinin/actin cytoskeleton. Increases AMPA receptor-mediated excitatory postsynaptic currents in neurons (By similarity). {By SimilarityUniProtKB:P36202, By SimilarityUniProtKB:P50479}.
Assigned Ontology terms

Biological Process	Actin Cytoskeleton Organization (GO:0030036) Actin Cytoskeleton Reorganization (GO:0031532) Excitatory Chemical Synaptic Transmission (GO:0098976) Heart Development (GO:0007507) Muscle Structure Development (GO:0061061) Positive Regulation Of Stress Fiber Assembly (GO:0051496)
Molecular Function	Actin Binding (GO:0003779) Actinin Binding (GO:0042805) Alpha-Actinin Binding (GO:0051393) Metal Ion Binding (GO:0046872) Muscle Alpha-Actinin Binding (GO:0051371) Protein Homodimerization Activity (GO:0042803) Protein Phosphatase Binding (GO:0019903)

Protein-Protein Interactions

Interactions with other proteins (6 interactors)

Partner (UniProt)		IntAct	Confidence score
Q15654	Thyroid receptor-interacting protein 6 (TR-interacting protein 6) (TRIP-6) (Opa-interacting protein 1) (OIP-1) (Zyxin-related protein 1) (ZRP-1)	EBI-7288337	0.37
Q9Z1Y4	Thyroid receptor-interacting protein 6 (TR-interacting protein 6) (TRIP-6) (Zyxin-related protein 1) (ZRP-1)	EBI-7288409	0.50
P15806	Transcription factor E2-alpha (Immunoglobulin enhancer-binding factor E12/E47) (Transcription factor 3) (TCF-3) (Transcription factor A1)	EBI-26677548	0.37
Q07279	Transcription factor NF-E2 45 kDa subunit (Leucine zipper protein NF-E2) (Nuclear factor, erythroid-derived 2 45 kDa subunit) (p45 NF-E2)	EBI-26677540	0.37
Q8CDC7	Zinc finger and BTB domain-containing protein 9	EBI-26678400	0.37
Q9D032	Single-stranded DNA-binding protein 3 (Lck-associated signal transducer) (Sequence-specific single-stranded-DNA-binding protein)	EBI-26682455	0.37

Cross-References

Database	Links
UNIPROT	P70271 Q5SWV2 Q8K0W4
Pfam	PF15936 PF00412 PF00595
PROSITE	PS00478 PS50023 PS50106

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK