Nesfatin-1 - Homo sapiens

Nesfatin-1 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Nesfatin-1
Accession Code	P80303
Gene	NUCB2
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 420)
MRWRTILLQYCFLLITCLLTALEAVPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDELKRQEVGRLRMLIKAKLDSLQDIGM DHQALLKQFDHLNHLNPDKFESTDLDMLIKAATSDLEHYDKTRHEEFKKYEMMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDVNSDGF LDEQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREHVMNEVDTNKDRLVTLEEFLKATEKKEFLEPDSWETLDQQQFFTEEELKEYENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYH QVIQQMEQKKLQQGIPPSGPAGELKFEPHI

Subcellular Location

Description
Golgi apparatus {Experimental EvidencePubMed:11749975}. Membrane {Experimental EvidencePubMed:11749975}; Peripheral membrane protein {Experimental EvidencePubMed:11749975}. Cytoplasm {Experimental EvidencePubMed:11749975}. Secreted {Experimental EvidencePubMed:11749975}. Endoplasmic reticulum {ECO:0000250}. Nucleus envelope {ECO:0000250}. Note=Golgi retention is mediated by its N-terminal region. [Nesfatin-1]: Secreted.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	Experimental Evidence {ECO:0000269\|PubMed:11749975}
Assigned Ontology terms

Cellular Component	Cytosol (GO:0005829) Endoplasmic Reticulum (GO:0005783) Endoplasmic Reticulum-Golgi Intermediate Compartment (GO:0005793) Extracellular Exosome (GO:0070062) Extracellular Space (GO:0005615) Golgi Apparatus (GO:0005794) Nuclear Envelope (GO:0005635) Plasma Membrane (GO:0005886)

Biology & Function

Description
Calcium-binding protein which may have a role in calcium homeostasis (By similarity). Acts as a non-receptor guanine nucleotide exchange factor which binds to and activates guanine nucleotide-binding protein (G-protein) alpha subunit GNAI3 (By similarity). {By SimilarityUniProtKB:P81117, By SimilarityUniProtKB:Q9JI85}. [Nesfatin-1]: Anorexigenic peptide, seems to play an important role in hypothalamic pathways regulating food intake and energy homeostasis, acting in a leptin-independent manner. May also exert hypertensive roles and modulate blood pressure through directly acting on peripheral arterial resistance. {By SimilarityUniProtKB:Q9JI85}.
Assigned Ontology terms

Biological Process	Negative Regulation Of Appetite (GO:0032099) Small GTPase Mediated Signal Transduction (GO:0007264)
Molecular Function	Calcium Ion Binding (GO:0005509) DNA Binding (GO:0003677) G-Protein Alpha-Subunit Binding (GO:0001965) Guanyl-Nucleotide Exchange Factor Activity (GO:0005085)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q99IB8	RNA-directed RNA polymerase	EBI-6927977	0.37
Interactions with other proteins (24 interactors)

Partner (UniProt)		IntAct	Confidence score
Q14790	Caspase-8 (CASP-8) (EC 3.4.22.61) (Apoptotic cysteine protease) (Apoptotic protease Mch-5) (CAP4) (FADD-homologous ICE/ced-3-like protease) (FADD-like ICE) (FLICE) (ICE-like apoptotic protease 5) (MORT1-associated ced-3 homolog) (MACH) [Cleaved into: Caspase-8 subunit p18; Caspase-8 subunit p10]	EBI-7740879	0.44
P55212	Caspase-6 (CASP-6) (CSP-6) (EC 3.4.22.59) (Apoptotic protease Mch-2) [Cleaved into: Caspase-6 subunit p18 (Caspase-6 subunit p20); Caspase-6 subunit p11 (Caspase-6 subunit p10)]	EBI-7740930	0.44
P55210	Caspase-7 (CASP-7) (EC 3.4.22.60) (Apoptotic protease Mch-3) (CMH-1) (ICE-like apoptotic protease 3) (ICE-LAP3) [Cleaved into: Caspase-7 subunit p20; Caspase-7 subunit p11]	EBI-7740913	0.44
P42574	Caspase-3 (CASP-3) (EC 3.4.22.56) (Apopain) (Cysteine protease CPP32) (CPP-32) (Protein Yama) (SREBP cleavage activity 1) (SCA-1) [Cleaved into: Caspase-3 subunit p17; Caspase-3 subunit p12]	EBI-7740963	0.44
Q3KSU8	Large tegument protein deneddylase (EC 3.4.19.12) (EC 3.4.22.-)	EBI-2623010	0.37
P24522	Growth arrest and DNA damage-inducible protein GADD45 alpha (DNA damage-inducible transcript 1 protein) (DDIT-1)	EBI-3928733	0.51
P08754	Guanine nucleotide-binding protein G(i) subunit alpha-3 (G(i) alpha-3)	EBI-3930095	0.37
P84996	Protein ALEX (Alternative gene product encoded by XL-exon)	EBI-3930125	0.37
Q96GM5	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 (60 kDa BRG-1/Brm-associated factor subunit A) (BRG1-associated factor 60A) (BAF60A) (SWI/SNF complex 60 kDa subunit)	EBI-3932795	0.37
O14980	Exportin-1 (Exp1) (Chromosome region maintenance 1 protein homolog)	EBI-3932805	0.37
Q13617	Cullin-2 (CUL-2)	EBI-21327106	0.35
Q2MV58	Tectonic-1	EBI-11366929	0.27
Q6NUS6	Tectonic-3	EBI-11368748	0.27
Q9H8J5	MANSC domain-containing protein 1 (Loss of heterozygosity 12 chromosomal region 3 protein)	EBI-21537025	0.35
P17275	Transcription factor JunB (Transcription factor AP-1 subunit JunB)	EBI-21713262	0.35
Q9Y6Z7	Collectin-10 (Collectin liver protein 1) (CL-L1) (Collectin-34) (CL-34)	EBI-21859525	0.35
P48788	Troponin I, fast skeletal muscle (Troponin I, fast-twitch isoform)	EBI-21878883	0.35
P59817	Zinc finger protein 280A (3'OY11.1) (Suppressor of hairy wing homolog 1) (Zinc finger protein 636)	EBI-21878952	0.35
O75489	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial (EC 7.1.1.2) (Complex I-30kD) (CI-30kD) (NADH-ubiquinone oxidoreductase 30 kDa subunit)	EBI-21931040	0.35
Q9NQH7	Xaa-Pro aminopeptidase 3 (X-Pro aminopeptidase 3) (EC 3.4.11.9) (Aminopeptidase P3) (APP3)	EBI-21937834	0.35
Q96T52	Mitochondrial inner membrane protease subunit 2 (EC 3.4.21.-) (IMP2-like protein)	EBI-27049069	0.27
P30530	Tyrosine-protein kinase receptor UFO (EC 2.7.10.1) (AXL oncogene)	EBI-32719959	0.27
Q5JZY3	Ephrin type-A receptor 10 (EC 2.7.10.1)	EBI-32720634	0.27
P07949	Proto-oncogene tyrosine-protein kinase receptor Ret (EC 2.7.10.1) (Cadherin family member 12) (Proto-oncogene c-Ret) [Cleaved into: Soluble RET kinase fragment; Extracellular cell-membrane anchored RET cadherin 120 kDa fragment]	EBI-32725031	0.27

Cross-References

Database	Links
UNIPROT	P80303 A8K642 D3DQX5 Q8NFT5 V9HW75
Pfam	PF13499
PROSITE	PS00018 PS50222
OMIM	608020
DisGeNET	4925

Nesfatin-1 (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Interactions with other proteins (24 interactors)

Cross-References

Database

Links

Description

Description