NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Tyrosine 3-monooxygenase - Caenorhabditis elegans - NucEnvDB

Tyrosine 3-monooxygenase (Caenorhabditis elegans)

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

General Information

Protein Information
Protein Name	Tyrosine 3-monooxygenase
Accession Code	P90986
Gene	cat
Organism	Caenorhabditis elegans (Taxonomy: 6239)
Part of Reference Proteome?	Yes
Sequence (Length: 519)
MSSLTNNTFMEEEPRGVTVIATKVAENSKNPRRYSLVHQASCETQHHKGIRRQNTIQHRKQLTDQMRCQKILQQLNDEGIEVIFTANDVTPIEFSIILTSTDPTLSNFVSDILQNMSSAKVQICHVETRG NEASHDVLLACKATKNQLIHSAELLTQNHVALTKFSIFAKKLSDEKNQSQIWFPRHISELDQCSKCITKYEPTTDPRHPGHGDVAYIARRKFLNDQALEFKFGDEIGYVDYTEEEHATWKAVYEKLGDLH LSHTCAVYRQNLKILQEEKVLTADRIPQIRDVNKFLQKKTGFELRPCSGLLSARDFLASLAFRVFQTTTYLRHHKSPHHSPEPDLIHELLGHVPMFSDPLLAQMSQDIGLMSLGASDEHIEKLSTVYWFI VEFGLCKEDGKLKAIGAGLLSAYGELMHACSDAPEHKDFDPAVTAVQKYEDDDYQPLYFVADSIHDALAKLRKYASSMDRPFSVVYDPFTKSIEAIESSADLEKAFSRLSNDLSAITHAADRMKISITM

Subcellular Location

Description
Cytoplasm, perinuclear region {By SimilarityUniProtKB:P24529}. Cell projection, axon {By SimilarityUniProtKB:P24529}. Note=Expressed in dopaminergic axons and axon terminals. {By SimilarityUniProtKB:P24529}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Axon (GO:0030424) Cytoplasm (GO:0005737) Perikaryon (GO:0043204) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Involved in the synthesis of catecholamines, such as dopamine. Has a role in serotonin signaling. Required for normal explorative and foraging behavior. In response to food, involved in promoting the dopamine-mediated suppression of crh-1/CREB1 transcription factor activation in cholinergic SIA neurons (PubMed:19609300). Modulates male mating behavior by controlling the protrusion of copulatory spicules from the tail of males during hermaphrodite vulval location (PubMed:23166505). {Experimental EvidencePubMed:14739932, Experimental EvidencePubMed:14762140, Experimental EvidencePubMed:17196529, Experimental EvidencePubMed:17268620, Experimental EvidencePubMed:19609300, Experimental EvidencePubMed:23166505}.
Assigned Ontology terms

Biological Process	Cellular Response To Amphetamine (GO:0071419) Dopamine Biosynthetic Process (GO:0042416) Dopamine Biosynthetic Process From Tyrosine (GO:0006585) Habituation (GO:0046959) Mechanosensory Behavior (GO:0007638) Negative Regulation Of Locomotion Involved In Locomotory Behavior (GO:0090327) Neurotransmitter Biosynthetic Process (GO:0042136) Positive Regulation Of Male Mating Behavior (GO:1902437) Regulation Of Locomotion (GO:0040012) Response To Food (GO:0032094) Spicule Insertion (GO:0034609) Turning Behavior Involved In Mating (GO:0034607)
Molecular Function	Iron Ion Binding (GO:0005506) Tyrosine 3-Monooxygenase Activity (GO:0004511)

Cross-References

Database	Links
UNIPROT	P90986 E7EM31 F2WZ21 Q5R3Y3 Q5R3Y4
Pfam	PF00351
PROSITE	PS00367 PS51410

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK