NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Homeobox protein Meis2 - Mus musculus - NucEnvDB

Homeobox protein Meis2 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Homeobox protein Meis2
Accession Code	P97367
Gene	Meis2
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 477)
MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQV RAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVA SPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGD YVSQGGPMGMGMAQPSYTPPQMTPHPTQLRHGPPMHSYLPSHPHHPAMVMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ

Subcellular Location

Description
Nucleus {Sequence AnalysisPROSITE-ProRule:PRU00108, Experimental EvidencePubMed:9710595}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:21059917}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Involved in transcriptional regulation. Binds to HOX or PBX proteins to form dimers, or to a DNA-bound dimer of PBX and HOX proteins and thought to have a role in stabilization of the homeoprotein-DNA complex. Isoform Meis2B is required for the activity of a PDX1:PBX1b:MEIS2b complex in pancreatic acinar cells involved in the transcriptional activation of the ELA1 enhancer; the complex binds to the enhancer B element and cooperates with the transcription factor 1 complex (PTF1) bound to the enhancer A element; MEIS2 is not involved in complex DNA-binding. Probably in complex with PBX1, is involved in transcriptional regulation by KLF4. Isoforms Meis2B and Meis2D can bind to a EPHA8 promoter sequence containing the DNA motif 5'-CGGTCA-3'; in cooperation with a PBX protein (such as PBX2) is proposed to be involved in the transcriptional activation of EPHA8 in the developing midbrain. May be involved in regulation of myeloid differentiation. Can bind to the DNA sequence 5'-TGACAG-3'in the activator ACT sequence of the D(1A) dopamine receptor (DRD1) promoter and activate DRD1 transcription. {Experimental EvidencePubMed:11279116, Experimental EvidencePubMed:11438208, Experimental EvidencePubMed:17178831}.
Assigned Ontology terms

Biological Process	Animal Organ Morphogenesis (GO:0009887) Brain Development (GO:0007420) Embryonic Pattern Specification (GO:0009880) Eye Development (GO:0001654) Negative Regulation Of Myeloid Cell Differentiation (GO:0045638) Pancreas Development (GO:0031016) Positive Regulation Of Cardiac Muscle Myoblast Proliferation (GO:0110024) Positive Regulation Of Cell Population Proliferation (GO:0008284) Positive Regulation Of Mitotic Cell Cycle (GO:0045931) Positive Regulation Of Transcription By RNA Polymerase II (GO:0045944) Regulation Of Transcription By RNA Polymerase II (GO:0006357) Response To Growth Factor (GO:0070848) Response To Mechanical Stimulus (GO:0009612) Visual Learning (GO:0008542)
Molecular Function	DNA Binding (GO:0003677) DNA-Binding Transcription Activator Activity, RNA Polymerase II-Specific (GO:0001228) DNA-Binding Transcription Factor Activity, RNA Polymerase II-Specific (GO:0000981) RNA Polymerase II Cis-Regulatory Region Sequence-Specific DNA Binding (GO:0000978) Sequence-Specific DNA Binding (GO:0043565) Sequence-Specific Double-Stranded DNA Binding (GO:1990837) Transcription Factor Binding (GO:0008134)

Protein-Protein Interactions

Interactions with other proteins (7 interactors)

Partner (UniProt)		IntAct	Confidence score
Q62424	Homeobox protein Hox-A13 (Homeobox protein Hox-1.10)	EBI-925672	0.00
Q04742	Homeobox protein EMX1 (Empty spiracles homolog 1) (Empty spiracles-like protein 1)	EBI-26670288	0.37
P41778	Pre-B-cell leukemia transcription factor 1 (Homeobox protein PBX1)	EBI-26671124	0.37
O35317	Pre-B-cell leukemia transcription factor 3 (Homeobox protein PBX3)	EBI-26671436	0.37
O35984	Pre-B-cell leukemia transcription factor 2 (Homeobox protein PBX2)	EBI-26671181	0.37
P15806	Transcription factor E2-alpha (Immunoglobulin enhancer-binding factor E12/E47) (Transcription factor 3) (TCF-3) (Transcription factor A1)	EBI-26673340	0.37
Q99NE9	Pre-B-cell leukemia transcription factor 4 (Homeobox protein PBX4)	EBI-26683990	0.37

Cross-References

Database	Links
UNIPROT	P97367 O35676 O35677 P97403 P97404
Pfam	PF05920 PF16493
PROSITE	PS50071

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK