Protein transport protein SEC13 - Saccharomyces cerevisiae S288C

Protein transport protein SEC13 (Saccharomyces cerevisiae S288C)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Protein transport protein SEC13
Accession Code	Q04491
Gene	SEC13
Organism	Saccharomyces cerevisiae S288C (Taxonomy: 559292)
Part of Reference Proteome?	Yes
Sequence (Length: 297)
MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVL IWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEE DGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ

Structure Viewer (PDB: 3IKO)

Subcellular Location

Description
Cytoplasmic vesicle, COPII-coated vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side. Nucleus, nuclear pore complex {Experimental EvidencePubMed:10684247}. Vacuole membrane; Peripheral membrane protein.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Pore Complex	SL-0185	The nuclear pore complex (NPC) constitutes the exclusive means of nucleocytoplasmic transport. NPCs allow the passive diffusion of ions and small molecules and the active bidirectional transport of macromolecules such as proteins, RNAs etc across the double-membrane nuclear envelope.The NPC is composed of at least 30 distinct subunits known as Nucleoporins (NUPs).
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cell Periphery (GO:0071944) COPII Vesicle Coat (GO:0030127) Endoplasmic Reticulum (GO:0005783) Endoplasmic Reticulum Membrane (GO:0005789) Nuclear Envelope (GO:0005635) Nuclear Pore (GO:0005643) Nuclear Pore Outer Ring (GO:0031080) Seh1-Associated Complex (GO:0035859) Vacuolar Membrane (GO:0005774)

Biology & Function

Description
Functions as a component of the nuclear pore complex (NPC) and the COPII coat. It is one of 5 proteins constituting the COPII coat, which is involved in anterograde (ER to Golgi) double-membrane transport vesicle formation. First the small GTPase SAR1, activated by and binding to the integral ER membrane protein SEC12, exchanges GDP for GTP and recruits the heterodimer SEC23/24, which in turn recruits the heterotetramer SEC13-SEC31. The polymerization of COPII coat complexes then causes physically the deformation (budding) of the membrane, leading to the creation of a transport vesicle. The COPII complex is dissociated upon SAR1-GTP hydrolysis to SAR1-GDP. SEC23 functions as the SAR1 GTPase activating protein, whose activity is stimulated in the presence of SEC13/31. SEC13 is directly or indirectly required for normal ER membrane and nuclear envelope morphology. It also functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. SEC13 is required for efficient mRNA export from the nucleus to the cytoplasm and for correct nuclear pore biogenesis and distribution. Component of the SEA complex which coats the vacuolar membrane and is involved in intracellular trafficking, autophagy, response to nitrogen starvation, and amino acid biogenesis. {Experimental EvidencePubMed:10684247, Experimental EvidencePubMed:10720463, Experimental EvidencePubMed:10747086, Experimental EvidencePubMed:11535824, Experimental EvidencePubMed:11717432, Experimental EvidencePubMed:11823431, Experimental EvidencePubMed:12215173, Experimental EvidencePubMed:12475940, Experimental EvidencePubMed:14627716, Experimental EvidencePubMed:21454883, Experimental EvidencePubMed:2188733, Experimental EvidencePubMed:6996832, Experimental EvidencePubMed:7026045, Experimental EvidencePubMed:8548805, Experimental EvidencePubMed:8565072, Experimental EvidencePubMed:8909535, Experimental EvidencePubMed:9023343, Experimental EvidencePubMed:9199164, Experimental EvidencePubMed:9409822, Experimental EvidencePubMed:9427388}.
Assigned Ontology terms

Biological Process	COPII-Coated Vesicle Budding (GO:0090114) MRNA Transport (GO:0051028) Nuclear Pore Localization (GO:0051664) Nucleocytoplasmic Transport (GO:0006913) Positive Regulation Of DNA-Templated Transcription (GO:0045893) Positive Regulation Of ER To Golgi Vesicle-Mediated Transport (GO:1902953) Positive Regulation Of GTPase Activity (GO:0043547) Positive Regulation Of Protein Exit From Endoplasmic Reticulum (GO:0070863) Positive Regulation Of TOR Signaling (GO:0032008) Positive Regulation Of TORC1 Signaling (GO:1904263) Protein Exit From Endoplasmic Reticulum (GO:0032527) Protein Import Into Nucleus (GO:0006606) Regulation Of TORC1 Signaling (GO:1903432) Ubiquitin-Dependent ERAD Pathway (GO:0030433)
Molecular Function	Structural Molecule Activity (GO:0005198)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (8 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P53011	Nucleoporin SEH1	EBI-812133	0.53
Q04491	Self	EBI-1580735	0.40
P40318	ERAD-associated E3 ubiquitin-protein ligase DOA10	EBI-939365	0.44
P35729	Nucleoporin NUP120	EBI-812133	0.88
P36161	Nucleoporin NUP133	EBI-16281671	0.35
P49687	Nucleoporin NUP145C	EBI-797641	0.97
P52891	Nucleoporin NUP84	EBI-800196	0.53
P46673	Nucleoporin NUP85	EBI-812133	0.53
Interactions with other proteins (27 interactors)

Partner (UniProt)		IntAct	Confidence score
Q03897	Maintenance of telomere capping protein 5 (SEH-associated protein 3)	EBI-392049	0.55
P48415	COPII coat assembly protein SEC16 (Protein transport protein SEC16)	EBI-784627	0.35
P41543	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 (N-linked oligosaccharyl transferase subunit 1) (Oligosaccharyl transferase 64 kDa subunit) (Oligosaccharyl transferase subunit OST1) (Oligosaccharyl transferase subunit alpha)	EBI-785977	0.35
Q06102	mRNA 3'-end-processing protein YTH1 (Yeast 30 kDa homolog 1)	EBI-786567	0.35
P38968	Protein transport protein SEC31 (Protein WEB1)	EBI-788839	0.84
P40482	Protein transport protein SEC24 (Abnormal nuclear morphology 1)	EBI-790183	0.35
P15303	Protein transport protein SEC23	EBI-796945	0.35
P32639	Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246)	EBI-798593	0.35
Q03103	Endoplasmic oxidoreductin-1 (EC 1.8.4.-) (Endoplasmic reticulum oxidoreductase protein 1)	EBI-811197	0.35
P11484	Ribosome-associated molecular chaperone SSB1 (EC 3.6.4.10) (Cold-inducible protein YG101) (Heat shock protein SSB1) (Hsp70 chaperone Ssb)	EBI-812133	0.35
P10592	Heat shock protein SSA2	EBI-812133	0.35
P32582	Cystathionine beta-synthase (EC 4.2.1.22) (Beta-thionase) (Serine sulfhydrase) (Sulfur transfer protein 4)	EBI-815440	0.27
P16474	Endoplasmic reticulum chaperone BiP (EC 3.6.4.10) (78 kDa glucose-regulated protein homolog) (GRP-78) (Immunoglobulin heavy chain-binding protein homolog) (BiP)	EBI-819047	0.27
P30619	Protein transport protein SEC1	EBI-7004382	0.44
Q04359	Sporulation-specific protein 20	EBI-2344074	0.37
P21965	Protein kinase MCK1 (EC 2.7.12.1) (Meiosis and centromere regulatory kinase)	EBI-2617565	0.35
Q01477	Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.4.19.12) (Deubiquitinating enzyme 3) (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3)	EBI-7992250	0.35
P53741	UBP3-associated protein BRE5 (Brefeldin-A sensitivity protein 5)	EBI-7994013	0.35
P10591	Heat shock protein SSA1 (Heat shock protein YG100)	EBI-3676810	0.53
P33416	Heat shock protein 78, mitochondrial	EBI-3747075	0.35
P47170	Vacuolar membrane-associated protein IML1 (Increased minichromosome loss protein 1) (SEH-associated protein 1)	EBI-9821605	0.58
P39923	Nitrogen permease regulator 2	EBI-9819823	0.35
Q08281	Restriction of telomere capping protein 1 (SEH-associated protein 2)	EBI-9819987	0.35
P38164	SEH-associated protein 4	EBI-9820321	0.35
P38732	Protein-lysine N-methyltransferase EFM1 (EC 2.1.1.-) (Elongation factor methyltransferase 1)	EBI-16281671	0.35
P15992	Heat shock protein 26 (26 kDa heat shock protein)	EBI-16281671	0.35
P05150	Ornithine carbamoyltransferase (EC 2.1.3.3) (Ornithine transcarbamylase) (OTCase)	EBI-16281671	0.35

Cross-References

Database	Links
UNIPROT	Q04491 D6VYK9
PDB	2PM6 2PM7 2PM9 3IKO 3JRO 3JRP 3MZK 3MZL 4BZJ 4BZK 4XMM 4XMN 6ZG5 6ZG6 6ZL0 7N84 7N9F
Pfam	PF00400
PROSITE	PS50082 PS50294

Protein transport protein SEC13 (Saccharomyces cerevisiae S288C)

General Information

Protein Information

Structure Viewer (PDB: 3IKO)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (8 interactors)

Interactions with other proteins (27 interactors)

Cross-References

Database

Links

Description

Description