NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

DNA repair protein RAD51 homolog 1 - Mus musculus - NucEnvDB

DNA repair protein RAD51 homolog 1 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	DNA repair protein RAD51 homolog 1
Accession Code	Q08297
Gene	Rad51
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 339)
MAMQMQLEASADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGYHTVEAVAYAPKKELINIKGISEAKADKILTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFR TGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFG VAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD

Subcellular Location

Description
Nucleus {By SimilarityUniProtKB:Q06609}. Cytoplasm {By SimilarityUniProtKB:Q06609}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:Q06609}. Mitochondrion matrix {By SimilarityUniProtKB:Q06609}. Chromosome {Experimental EvidencePubMed:30272023, Experimental EvidencePubMed:30746471, ECO:0000269\|PubMed:30760716, ECO:0000269\|PubMed:30949703, ECO:0000269\|PubMed:32463460}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {By SimilarityUniProtKB:Q06609}. Note=Colocalizes with RAD51AP1 and RPA2 to multiple nuclear foci upon induction of DNA damage. DNA damage induces an increase in nuclear levels. Together with FIGNL1, redistributed in discrete nuclear DNA damage-induced foci after ionizing radiation (IR) or camptothecin (CPT) treatment. Accumulated at sites of DNA damage in a SPIDR-dependent manner. Recruited at sites of DNA damage in a MCM9-MCM8-dependent manner. Colocalizes with ERCC5/XPG to nuclear foci in S phase. Recruited to stalled replication forks during replication stress by the TONSL-MMS22L complex, as well as ATAD5 and WDR48 in an ATR-dependent manner. {By SimilarityUniProtKB:Q06609}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Chromatin (GO:0000785) Chromosome (GO:0005694) Chromosome, Telomeric Region (GO:0000781) Condensed Chromosome (GO:0000793) Condensed Nuclear Chromosome (GO:0000794) Cytoplasm (GO:0005737) Lateral Element (GO:0000800) Male Germ Cell Nucleus (GO:0001673) Microtubule Organizing Center (GO:0005815) Mitochondrial Matrix (GO:0005759) Mitochondrion (GO:0005739) Nuclear Chromosome (GO:0000228) Nuclear Ubiquitin Ligase Complex (GO:0000152) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) PML Body (GO:0016605) Protein-Containing Complex (GO:0032991) Site Of Double-Strand Break (GO:0035861) Synaptonemal Complex (GO:0000795)

Biology & Function

Description
Plays an important role in homologous strand exchange, a key step in DNA repair through homologous recombination (HR) (PubMed:15834424). Binds to single-stranded DNA in an ATP-dependent manner to form nucleoprotein filaments which are essential for the homology search and strand exchange. Catalyzes the recognition of homology and strand exchange between homologous DNA partners to form a joint molecule between a processed DNA break and the repair template. Recruited to resolve stalled replication forks during replication stress. Part of a PALB2-scaffolded HR complex containing BRCA2 and RAD51C and which is thought to play a role in DNA repair by HR. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51C and XRCC3. Also involved in interstrand cross-link repair (By similarity). {By SimilarityUniProtKB:Q06609, Experimental EvidencePubMed:15834424}.
Assigned Ontology terms

Biological Process	Cellular Response To Alkaloid (GO:0071312) Cellular Response To Camptothecin (GO:0072757) Cellular Response To Cisplatin (GO:0072719) Cellular Response To DNA Damage Stimulus (GO:0006974) Cellular Response To Gamma Radiation (GO:0071480) Cellular Response To Hydroxyurea (GO:0072711) Cellular Response To Ionizing Radiation (GO:0071479) Chromosome Organization Involved In Meiotic Cell Cycle (GO:0070192) DNA Recombinase Assembly (GO:0000730) DNA Repair (GO:0006281) DNA Unwinding Involved In DNA Replication (GO:0006268) Double-Strand Break Repair Via Homologous Recombination (GO:0000724) Histone H2A Monoubiquitination (GO:0035518) Interstrand Cross-Link Repair (GO:0036297) Meiotic Cell Cycle (GO:0051321) Mitotic Recombination (GO:0006312) Mitotic Recombination-Dependent Replication Fork Processing (GO:1990426) Positive Regulation Of DNA Ligation (GO:0051106) Protein Autoubiquitination (GO:0051865) Reciprocal Meiotic Recombination (GO:0007131) Regulation Of DNA Damage Checkpoint (GO:2000001) Regulation Of Double-Strand Break Repair Via Homologous Recombination (GO:0010569) Regulation Of Protein Phosphorylation (GO:0001932) Replication Fork Processing (GO:0031297) Replication-Born Double-Strand Break Repair Via Sister Chromatid Exchange (GO:1990414) Response To Glucoside (GO:1904631) Response To Toxic Substance (GO:0009636) Response To X-Ray (GO:0010165) Response To Xenobiotic Stimulus (GO:0009410) Strand Invasion (GO:0042148) Telomere Maintenance Via Recombination (GO:0000722) Telomere Maintenance Via Telomere Lengthening (GO:0010833) Telomere Organization (GO:0032200)
Molecular Function	ATP Binding (GO:0005524) ATP-Dependent Activity, Acting On DNA (GO:0008094) ATP-Dependent DNA Damage Sensor Activity (GO:0140664) Chromatin Binding (GO:0003682) DNA Polymerase Binding (GO:0070182) DNA Strand Exchange Activity (GO:0000150) Double-Stranded DNA Binding (GO:0003690) Enzyme Binding (GO:0019899) Identical Protein Binding (GO:0042802) Protein C-Terminus Binding (GO:0008022) Single-Stranded DNA Binding (GO:0003697) Single-Stranded DNA Helicase Activity (GO:0017116)

Protein-Protein Interactions

Interactions with other proteins (1 interactors)

Partner (UniProt)		IntAct	Confidence score
Q8K396	Meiotic nuclear division protein 1 homolog	EBI-310417	0.37

Cross-References

Database	Links
UNIPROT	Q08297 Q3UAY5
Pfam	PF08423
PROSITE	PS50162 PS50163

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK