Dual specificity testis-specific protein kinase 1 - Homo sapiens

Dual specificity testis-specific protein kinase 1 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Dual specificity testis-specific protein kinase 1
Accession Code	Q15569
Gene	TESK1
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 626)
MAGERPPLRGPGPGPGEVPGEGPPGPGGTGGGPGRGRPSSYRALRSAVSSLARVDDFHCAEKIGAGFFSEVYKVRHRQSGQVMVLKMNKLPSNRGNTLREVQLMNRLRHPNILRFMGVCVHQGQLHALTE YMNGGTLEQLLSSPEPLSWPVRLHLALDIARGLRYLHSKGVFHRDLTSKNCLVRREDRGFTAVVGDFGLAEKIPVYREGARKEPLAVVGSPYWMAPEVLRGELYDEKADVFAFGIVLCELIARVPADPDY LPRTEDFGLDVPAFRTLVGDDCPLPFLLLAIHCCNLEPSTRAPFTEITQHLEWILEQLPEPAPLTRTALTHNQGSVARGGPSATLPRPDPRLSRSRSDLFLPPSPESPPNWGDNLTRVNPFSLREDLRGG KIKLLDTPSKPVLPLVPPSPFPSTQLPLVTTPETLVQPGTPARRCRSLPSSPELPRRMETALPGPGPPAVGPSAEEKMECEGSSPEPEPPGPAPQLPLAVATDNFISTCSSASQPWSPRSGPVLNNNPPA VVVNSPQGWAGEPWNRAQHSLPRAAALERTEPSPPPSAPREPDEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNCEAGSLLCHRGHHAKPPTPSLQLPGARS

Subcellular Location

Description
Cytoplasm {Experimental EvidencePubMed:15584898}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:Q63572}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {Experimental EvidencePubMed:25849865}. Cell projection, lamellipodium {By SimilarityUniProtKB:Q63572}. Note=Colocalizes with SPRY4 in vesicular spots in the cytoplasm (PubMed:15584898). Localized to F- actin-rich lamellipodia at the cell periphery following fibronectin- mediated cell adhesion of Schwann cells (By similarity). {By SimilarityUniProtKB:Q63572, Experimental EvidencePubMed:15584898}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Centrosome (GO:0005813) Cytoplasm (GO:0005737) Cytoplasmic Vesicle (GO:0031410) Cytosol (GO:0005829) Lamellipodium (GO:0030027) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Dual specificity protein kinase activity catalyzing autophosphorylation and phosphorylation of exogenous substrates on both serine/threonine and tyrosine residues (By similarity). Regulates the cellular cytoskeleton by enhancing actin stress fiber formation via phosphorylation of cofilin and by preventing microtubule breakdown via inhibition of TAOK1/MARKK kinase activity (By similarity). Inhibits podocyte motility via regulation of actin cytoskeletal dynamics and phosphorylation of CFL1 (By similarity). Positively regulates integrin- mediated cell spreading, via phosphorylation of cofilin (PubMed:15584898). Suppresses ciliogenesis via multiple pathways; phosphorylation of CFL1, suppression of ciliary vesicle directional trafficking to the ciliary base, and by facilitating YAP1 nuclear localization where it acts as a transcriptional corepressor of the TEAD4 target genes AURKA and PLK1 (PubMed:25849865). Probably plays a central role at and after the meiotic phase of spermatogenesis (By similarity). {By SimilarityUniProtKB:O70146, By SimilarityUniProtKB:Q63572, Experimental EvidencePubMed:15584898, Experimental EvidencePubMed:25849865}.
Assigned Ontology terms

Biological Process	Actin Cytoskeleton Organization (GO:0030036) Establishment Of Vesicle Localization (GO:0051650) Negative Regulation Of Cilium Assembly (GO:1902018) Negative Regulation Of Phosphorylation (GO:0042326) Negative Regulation Of Protein Autophosphorylation (GO:0031953) Negative Regulation Of Protein Serine/Threonine Kinase Activity (GO:0071901) Podocyte Cell Migration (GO:0090521) Positive Regulation Of Protein Localization To Nucleus (GO:1900182) Positive Regulation Of Protein Phosphorylation (GO:0001934) Positive Regulation Of Stress Fiber Assembly (GO:0051496) Positive Regulation Of Substrate Adhesion-Dependent Cell Spreading (GO:1900026) Regulation Of Actin Cytoskeleton Organization (GO:0032956) Regulation Of Protein Localization (GO:0032880) Spermatogenesis (GO:0007283)
Molecular Function	ATP Binding (GO:0005524) Metal Ion Binding (GO:0046872) Protein C-Terminus Binding (GO:0008022) Protein Kinase Activity (GO:0004672) Protein Kinase Binding (GO:0019901) Protein Serine Kinase Activity (GO:0106310) Protein Serine/Threonine Kinase Activity (GO:0004674) Protein Serine/Threonine/Tyrosine Kinase Activity (GO:0004712) Protein Tyrosine Kinase Activity (GO:0004713)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q6P5Z2	Serine/threonine-protein kinase N3	EBI-28941754	0.35
Interactions with other proteins (21 interactors)

Partner (UniProt)		IntAct	Confidence score
P31946	14-3-3 protein beta/alpha (Protein 1054) (Protein kinase C inhibitor protein 1) (KCIP-1) [Cleaved into: 14-3-3 protein beta/alpha, N-terminally processed]	EBI-7969808	0.61
Q9C004	Protein sprouty homolog 4 (Spry-4)	EBI-354851	0.51
P10398	Serine/threonine-protein kinase A-Raf (EC 2.7.11.1) (Proto-oncogene A-Raf) (Proto-oncogene A-Raf-1) (Proto-oncogene Pks)	EBI-3905576	0.37
P17858	ATP-dependent 6-phosphofructokinase, liver type (ATP-PFK) (PFK-L) (EC 2.7.1.11) (6-phosphofructokinase type B) (Phosphofructo-1-kinase isozyme B) (PFK-B) (Phosphohexokinase)	EBI-3912189	0.37
P21439	Phosphatidylcholine translocator ABCB4 (EC 7.6.2.1) (ATP-binding cassette sub-family B member 4) (Multidrug resistance protein 3) (P-glycoprotein 3)	EBI-3912199	0.37
P25490	Transcriptional repressor protein YY1 (Delta transcription factor) (INO80 complex subunit S) (NF-E1) (Yin and yang 1) (YY-1)	EBI-3913625	0.37
P08238	Heat shock protein HSP 90-beta (HSP 90) (Heat shock 84 kDa) (HSP 84) (HSP84)	EBI-6423722	0.40
Q9NQZ2	Something about silencing protein 10 (Charged amino acid-rich leucine zipper 1) (CRL1) (Disrupter of silencing SAS10) (UTP3 homolog)	EBI-28941326	0.35
Q96JB2	Conserved oligomeric Golgi complex subunit 3 (COG complex subunit 3) (Component of oligomeric Golgi complex 3) (Vesicle-docking protein SEC34 homolog) (p94)	EBI-28941326	0.35
Q96CP6	Protein Aster-A (GRAM domain-containing protein 1A)	EBI-28941326	0.35
Q8ND56	Protein LSM14 homolog A (Protein FAM61A) (Protein SCD6 homolog) (Putative alpha-synuclein-binding protein) (AlphaSNBP) (RNA-associated protein 55A) (hRAP55) (hRAP55A)	EBI-28941326	0.35
Q7Z6M1	Rab9 effector protein with kelch motifs (40 kDa Rab9 effector protein) (p40)	EBI-28941326	0.35
Q14257	Reticulocalbin-2 (Calcium-binding protein ERC-55) (E6-binding protein) (E6BP)	EBI-28941326	0.35
Q04917	14-3-3 protein eta (Protein AS1)	EBI-28941326	0.35
P61981	14-3-3 protein gamma (Protein kinase C inhibitor protein 1) (KCIP-1) [Cleaved into: 14-3-3 protein gamma, N-terminally processed]	EBI-28941326	0.35
P24666	Low molecular weight phosphotyrosine protein phosphatase (LMW-PTP) (LMW-PTPase) (EC 3.1.3.48) (Adipocyte acid phosphatase) (Low molecular weight cytosolic acid phosphatase) (EC 3.1.3.2) (Red cell acid phosphatase 1)	EBI-28941326	0.35
P00367	Glutamate dehydrogenase 1, mitochondrial (GDH 1) (EC 1.4.1.3)	EBI-28941326	0.35
O75592	E3 ubiquitin-protein ligase MYCBP2 (EC 2.3.2.33) (Myc-binding protein 2) (Protein associated with Myc)	EBI-28941326	0.35
O00763	Acetyl-CoA carboxylase 2 (EC 6.4.1.2) (ACC-beta)	EBI-28941326	0.35
Q8WTQ7	Rhodopsin kinase GRK7 (EC 2.7.11.14) (G protein-coupled receptor kinase 7) (G protein-coupled receptor kinase GRK7)	EBI-28943996	0.35
Q96S53	Dual specificity testis-specific protein kinase 2 (EC 2.7.12.1) (Testicular protein kinase 2)	EBI-28944692	0.35

Cross-References

Database	Links
UNIPROT	Q15569 Q8IXZ8
Pfam	PF07714
PROSITE	PS00107 PS50011 PS00109
OMIM	601782
DisGeNET	7016

Dual specificity testis-specific protein kinase 1 (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Interactions with other proteins (21 interactors)

Cross-References

Database

Links

Description

Description