RISC-loading complex subunit TARBP2 - Homo sapiens

RISC-loading complex subunit TARBP2 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	RISC-loading complex subunit TARBP2
Accession Code	Q15633
Gene	TARBP2
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 366)
MSEEEQGSGTTTGCGLPSIEQMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCTGQGPSK KAAKHKAAEVALKHLKGGSMLEPALEDSSSFSPLDSSLPEDIPVFTAAAAATPVPSVVLTRSPPMELQPPVSPQQSECNP VGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHTVPLDARDGNEVEP DDDHFSIGVGSRLDGLRNRGPGCTWDSLRNSVGEKILSLRSCSLGSLGALGPACCRVLSELSEEQAFHVSYLDIEELSLS GLCQCLVELSTQPATVCHGSATTREAARGEAARRALQYLKIMAGSK

Structure Viewer (PDB: 5ZAL)

Subcellular Location

Description
Cytoplasm. Cytoplasm, perinuclear region. Nucleus.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Cytosol (GO:0005829) Nuclear Body (GO:0016604) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) RISC Complex (GO:0016442) RISC-Loading Complex (GO:0070578)

Biology & Function

Description
Required for formation of the RNA induced silencing complex (RISC). Component of the RISC loading complex (RLC), also known as the micro-RNA (miRNA) loading complex (miRLC), which is composed of DICER1, AGO2 and TARBP2. Within the RLC/miRLC, DICER1 and TARBP2 are required to process precursor miRNAs (pre-miRNAs) to mature miRNAs and then load them onto AGO2. AGO2 bound to the mature miRNA constitutes the minimal RISC and may subsequently dissociate from DICER1 and TARBP2. May also play a role in the production of short interfering RNAs (siRNAs) from double-stranded RNA (dsRNA) by DICER1. {Sequence AnalysisHAMAP- Rule:MF_03034, Experimental EvidencePubMed:15973356, Experimental EvidencePubMed:16142218, Experimental EvidencePubMed:16271387, Experimental EvidencePubMed:16357216, Experimental EvidencePubMed:16424907, Experimental EvidencePubMed:17452327, Experimental EvidencePubMed:18178619}. (Microbial infection) Binds to the HIV-1 TAR RNA which is located in the long terminal repeat (LTR) of HIV-1, and stimulates translation of TAR-containing RNAs (PubMed:2011739, PubMed:11438532, PubMed:12475984). This is achieved in part at least by binding to and inhibiting EIF2AK2/PKR, thereby reducing phosphorylation and inhibition of EIF2S1/eIF-2-alpha (PubMed:11438532). May also promote translation of TAR-containing RNAs independently of EIF2AK2/PKR (PubMed:12475984). Mediates recruitment of FTSJ3 methyltransferase to HIV-1 RNA, leading to 2'-O-methylation of the viral genome, allowing HIV-1 to escape the innate immune system (PubMed:30626973). {Experimental EvidencePubMed:11438532, Experimental EvidencePubMed:12475984, Experimental EvidencePubMed:2011739, Experimental EvidencePubMed:30626973}.
Assigned Ontology terms

Biological Process	Global Gene Silencing By MRNA Cleavage (GO:0098795) MiRNA Processing (GO:0035196) Multicellular Organism Growth (GO:0035264) Negative Regulation Of Defense Response To Virus By Host (GO:0050689) Negative Regulation Of Protein Kinase Activity (GO:0006469) Neural Precursor Cell Proliferation (GO:0061351) Positive Regulation Of Muscle Cell Differentiation (GO:0051149) Positive Regulation Of Translation (GO:0045727) Positive Regulation Of Viral Genome Replication (GO:0045070) Pre-MiRNA Processing (GO:0031054) Regulation Of MiRNA Maturation (GO:1903798) Regulation Of Production Of Small RNA Involved In Gene Silencing By RNA (GO:0070920) Regulation Of SiRNA Production (GO:0070921) Regulation Of Viral Transcription (GO:0046782) RISC Complex Assembly (GO:0070922) Single Fertilization (GO:0007338) SiRNA Processing (GO:0030422) Skeletal Muscle Tissue Regeneration (GO:0043403) Spermatid Development (GO:0007286)
Molecular Function	Double-Stranded RNA Binding (GO:0003725) Enzyme Binding (GO:0019899) Identical Protein Binding (GO:0042802) MiRNA Binding (GO:0035198) Pre-MiRNA Binding (GO:0070883) Pre-MRNA Binding (GO:0036002) Protein Homodimerization Activity (GO:0042803) Protein N-Terminus Binding (GO:0047485) SiRNA Binding (GO:0035197)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (5 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q15633	Self	EBI-10485546	0.74
Q9UPY3	Endoribonuclease Dicer	EBI-8031567	0.96
P19525	Interferon-induced, double-stranded RNA-activated protein kinase	EBI-6116026	0.50
A0A142I5B9	RNA-directed RNA polymerase NS5	EBI-20625330	0.35
O75569	Interferon-inducible double-stranded RNA-dependent protein kinase activator A	EBI-8031712	0.89
Interactions with other proteins (56 interactors)

Partner (UniProt)		IntAct	Confidence score
Q9UKV8	Protein argonaute-2 (Argonaute2) (hAgo2) (EC 3.1.26.n2) (Argonaute RISC catalytic component 2) (Eukaryotic translation initiation factor 2C 2) (eIF-2C 2) (eIF2C 2) (PAZ Piwi domain protein) (PPD) (Protein slicer)	EBI-8031655	0.93
Q9UL18	Protein argonaute-1 (Argonaute1) (hAgo1) (Argonaute RISC catalytic component 1) (Eukaryotic translation initiation factor 2C 1) (eIF-2C 1) (eIF2C 1) (Putative RNA-binding protein Q99)	EBI-7641457	0.53
Q6ZVK8	8-oxo-dGDP phosphatase NUDT18 (EC 3.6.1.58) (2-hydroxy-dADP phosphatase) (7,8-dihydro-8-oxoguanine phosphatase) (MutT homolog 3) (Nucleoside diphosphate-linked moiety X motif 18) (Nudix motif 18)	EBI-2350587	0.49
P03496	Non-structural protein 1 (NS1) (NS1A)	EBI-2547901	0.55
P03495	Non-structural protein 1 (NS1) (NS1A)	EBI-2549180	0.37
P52735	Guanine nucleotide exchange factor VAV2 (VAV-2)	EBI-2654474	0.00
Q13618	Cullin-3 (CUL-3)	EBI-21329068	0.35
P04792	Heat shock protein beta-1 (HspB1) (28 kDa heat shock protein) (Estrogen-regulated 24 kDa protein) (Heat shock 27 kDa protein) (HSP 27) (Stress-responsive protein 27) (SRP27)	EBI-6870660	0.37
P55265	Double-stranded RNA-specific adenosine deaminase (DRADA) (EC 3.5.4.37) (136 kDa double-stranded RNA-binding protein) (p136) (Interferon-inducible protein 4) (IFI-4) (K88DSRBP)	EBI-6913278	0.50
Q13387	C-Jun-amino-terminal kinase-interacting protein 2 (JIP-2) (JNK-interacting protein 2) (Islet-brain-2) (IB-2) (JNK MAP kinase scaffold protein 2) (Mitogen-activated protein kinase 8-interacting protein 2)	EBI-10699487	0.37
Q8N8B7	Transcription elongation factor A N-terminal and central domain-containing protein (TFIIS central domain-containing protein 1)	EBI-10267829	0.56
Q96SI9	Spermatid perinuclear RNA-binding protein	EBI-10293396	0.56
Q9UL40	Zinc finger protein 346 (Just another zinc finger protein)	EBI-10323534	0.72
Q99PL5	Ribosome-binding protein 1 (Ribosome receptor protein) (RRp) (mRRp)	EBI-11066888	0.35
F8VQ54	Endoribonuclease Dicer (EC 3.1.26.3)	EBI-11102475	0.35
Q20MH3	Non-structural protein 1 (NS1)	EBI-11520008	0.37
Q0A2H0	Non-structural protein 1 (NS1) (NS1A)	EBI-11520163	0.37
Q2PJP0	Non-structural protein 1 (NS1)	EBI-11520373	0.37
Q6DP93	Non-structural protein 1 (NS1)	EBI-11520588	0.37
O92551	Non-structural protein 1 (NS1) (NS1A)	EBI-11520755	0.37
Q3SBS4	Non-structural protein 1 (NS1)	EBI-11520855	0.37
Q9Y6A4	Cilia- and flagella-associated protein 20 (Basal body up-regulated protein 22) (Transcription factor IIB)	EBI-12449464	0.51
Q15560	Transcription elongation factor A protein 2 (Testis-specific S-II) (Transcription elongation factor S-II protein 2) (Transcription elongation factor TFIIS.l)	EBI-24355055	0.56
P78563	Double-stranded RNA-specific editase 1 (EC 3.5.4.37) (RNA-editing deaminase 1) (RNA-editing enzyme 1) (dsRNA adenosine deaminase)	EBI-24399962	0.56
Q9HA38	Zinc finger matrin-type protein 3 (Zinc finger protein WIG-1) (p53-activated gene 608 protein)	EBI-24407531	0.56
Q96T60	Bifunctional polynucleotide phosphatase/kinase (DNA 5'-kinase/3'-phosphatase) (Polynucleotide kinase-3'-phosphatase) [Includes: Polynucleotide 3'-phosphatase (EC 3.1.3.32) (2'(3')-polynucleotidase); Polynucleotide 5'-hydroxyl-kinase (EC 2.7.1.78)]	EBI-24457278	0.56
Q9H898	Zinc finger matrin-type protein 4	EBI-24634332	0.56
Q8IWL3	Iron-sulfur cluster co-chaperone protein HscB (DnaJ homolog subfamily C member 20) [Cleaved into: Iron-sulfur cluster co-chaperone protein HscB, cytoplasmic (C-HSC20); Iron-sulfur cluster co-chaperone protein HscB, mitochondrial]	EBI-13943458	0.35
Q6IQ23	Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7)	EBI-16400551	0.35
O60716	Catenin delta-1 (Cadherin-associated Src substrate) (CAS) (p120 catenin) (p120(ctn)) (p120(cas))	EBI-16400931	0.35
Q8N490	Probable hydrolase PNKD (EC 3.-.-.-) (Myofibrillogenesis regulator 1) (MR-1) (Paroxysmal nonkinesiogenic dyskinesia protein) (Trans-activated by hepatitis C virus core protein 2)	EBI-21596986	0.35
Q8IZ69	tRNA (uracil-5-)-methyltransferase homolog A (EC 2.1.1.35) (mRNA (uracil-5-)-methyltransferase TRMT2A) (EC 2.1.1.-)	EBI-21636338	0.35
Q8WV44	E3 ubiquitin-protein ligase TRIM41 (EC 2.3.2.27) (RING finger-interacting protein with C kinase) (RINCK) (Tripartite motif-containing protein 41)	EBI-21636495	0.35
O14965	Aurora kinase A (EC 2.7.11.1) (Aurora 2) (Aurora/IPL1-related kinase 1) (ARK-1) (Aurora-related kinase 1) (Breast tumor-amplified kinase) (Ipl1- and aurora-related kinase 1) (Serine/threonine-protein kinase 15) (Serine/threonine-protein kinase 6) (Serine/threonine-protein kinase Ayk1) (Serine/threonine-protein kinase aurora-A)	EBI-21639587	0.35
O75173	A disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAM-TS 4) (ADAM-TS4) (ADAMTS-4) (EC 3.4.24.82) (ADMP-1) (Aggrecanase-1)	EBI-21640424	0.35
Q12905	Interleukin enhancer-binding factor 2 (Nuclear factor of activated T-cells 45 kDa)	EBI-21665924	0.35
Q9NQ55	Suppressor of SWI4 1 homolog (Ssf-1) (Brix domain-containing protein 3) (Peter Pan homolog)	EBI-21667205	0.35
P61313	60S ribosomal protein L15 (Large ribosomal subunit protein eL15)	EBI-21697528	0.35
Q3SYB3	Forkhead box protein D4-like 6 (FOXD4-like 6)	EBI-21720692	0.35
Q8N4T0	Carboxypeptidase A6 (EC 3.4.17.-)	EBI-21731449	0.35
B0UZZ8	Chromosome 6 open reading frame 11 (WD repeat domain 46, isoform CRA_d) (cDNA, FLJ96697)	EBI-21740634	0.35
O95793	Double-stranded RNA-binding protein Staufen homolog 1	EBI-21741139	0.35
Q6ZRI8	Rho GTPase-activating protein 36	EBI-21744920	0.35
Q96BR6	Zinc finger protein 669	EBI-21784034	0.35
Q9BWM7	Sideroflexin-3	EBI-21849539	0.35
Q9Y316	Protein MEMO1 (C21orf19-like protein) (Hepatitis C virus NS5A-transactivated protein 7) (HCV NS5A-transactivated protein 7) (Mediator of ErbB2-driven cell motility 1) (Mediator of cell motility 1) (Memo-1)	EBI-21887469	0.35
Q92945	Far upstream element-binding protein 2 (FUSE-binding protein 2) (KH type-splicing regulatory protein) (KSRP) (p75)	EBI-15782041	0.40
P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	EBI-21301141	0.35
P59633	ORF3b protein (Accessory protein 3b) (Non-structural protein 3b) (ns3b) (Protein X2)	EBI-25688366	0.35
Q9IK90	Matrix protein (Protein M)	EBI-25747144	0.35
Q9Y2W7	Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3)	EBI-26677564	0.37
Q9GZN2	Homeobox protein TGIF2 (5'-TG-3'-interacting factor 2) (TGF-beta-induced transcription factor 2) (TGFB-induced factor 2)	EBI-26680078	0.37
Q92886	Neurogenin-1 (NGN-1) (Class A basic helix-loop-helix protein 6) (bHLHa6) (Neurogenic basic-helix-loop-helix protein) (Neurogenic differentiation factor 3) (NeuroD3)	EBI-26681411	0.37
Q9Y6K9	NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier)	EBI-26685205	0.37
Q13503	Mediator of RNA polymerase II transcription subunit 21 (Mediator complex subunit 21) (RNA polymerase II holoenzyme component SRB7) (RNAPII complex component SRB7) (hSrb7)	EBI-26685861	0.37
P0DTC9	Nucleoprotein (N) (Nucleocapsid protein) (NC) (Protein N)	EBI-26948726	0.70

Cross-References

Database	Links
UNIPROT	Q15633 Q12878 Q8WY32 Q8WY33 Q9BRY2
PDB	2CPN 3ADL 3LLH 4WYQ 5N8L 5N8M 5ZAK 5ZAL 5ZAM 6ZBK
Pfam	PF00035
PROSITE	PS50137
OMIM	605053
DisGeNET	6895

RISC-loading complex subunit TARBP2 (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 5ZAL)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (5 interactors)

Interactions with other proteins (56 interactors)

Cross-References

Database

Links

Description

Description