NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Cyclin-dependent kinase 5 activator 1, p25 - Bos taurus - NucEnvDB

Cyclin-dependent kinase 5 activator 1, p25 (Bos taurus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Cyclin-dependent kinase 5 activator 1, p25
Accession Code	Q28199
Gene	CDK5R1
Organism	Bos taurus \| Cattle (Taxonomy: 9913)
Part of Reference Proteome?	Yes
Sequence (Length: 307)
MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGVSSSVKKAPH PAVSSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDR CLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR

Subcellular Location

Description
[Cyclin-dependent kinase 5 activator 1, p35]: Cell membrane {By SimilarityUniProtKB:Q15078}; Lipid-anchor {By SimilarityUniProtKB:Q15078}; Cytoplasmic side {By SimilarityUniProtKB:Q15078}. Cell projection, neuron projection {By SimilarityUniProtKB:Q15078}. Note=In the primary cortical neurons, p35 is present in the peripheries and nerve terminals. {By SimilarityUniProtKB:Q15078}. [Cyclin-dependent kinase 5 activator 1, p25]: Nucleus {By SimilarityUniProtKB:Q15078}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:Q15078}. Perikaryon {By SimilarityUniProtKB:Q15078}. Note=The conversion of p35 to p25 relocalizes the protein from the cell periphery to the cytoplasm, in nuclear and perinuclear regions. In the primary cortical neurons, p25 is primarily concentrated in the cell soma and is largely absent from neurites. {By SimilarityUniProtKB:Q15078}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Lipid-Anchored	UniProt	By Similarity {ECO:0000250}
Assigned Ontology terms

Cellular Component	Axon (GO:0030424) Contractile Fiber (GO:0043292) Cyclin-Dependent Protein Kinase Holoenzyme Complex (GO:0000307) Cytoplasm (GO:0005737) Dendrite (GO:0030425) Dendritic Spine (GO:0043197) Growth Cone (GO:0030426) Membrane (GO:0016020) Neuromuscular Junction (GO:0031594) Neuron Projection (GO:0043005) Neuronal Cell Body (GO:0043025) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perikaryon (GO:0043204) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Postsynaptic Density (GO:0014069) Protein Kinase 5 Complex (GO:0016533)

Biology & Function

Description
p35 is a neuron specific activator of CDK5. The complex p35/CDK5 is required for neurite outgrowth and cortical lamination. Involved in dendritic spine morphogenesis by mediating the EFNA1-EPHA4 signaling. Activator of TPKII. The complex p35/CDK5 participates in the regulation of the circadian clock by modulating the function of CLOCK protein: phosphorylates CLOCK at 'Thr-451' and 'Thr-461' and regulates the transcriptional activity of the CLOCK-ARNTL/BMAL1 heterodimer in association with altered stability and subcellular distribution. {By SimilarityUniProtKB:Q15078}.
Assigned Ontology terms

Biological Process	Axon Guidance (GO:0007411) Axonal Fasciculation (GO:0007413) Brain Development (GO:0007420) Cerebellum Development (GO:0021549) Embryo Development Ending In Birth Or Egg Hatching (GO:0009792) Ephrin Receptor Signaling Pathway (GO:0048013) G Protein-Coupled Acetylcholine Receptor Signaling Pathway (GO:0007213) G1 To G0 Transition Involved In Cell Differentiation (GO:0070315) Hippocampus Development (GO:0021766) Ionotropic Glutamate Receptor Signaling Pathway (GO:0035235) Layer Formation In Cerebral Cortex (GO:0021819) Negative Regulation Of DNA-Templated Transcription (GO:0045892) Neuron Cell-Cell Adhesion (GO:0007158) Neuron Differentiation (GO:0030182) Neuron Migration (GO:0001764) Neuron Projection Development (GO:0031175) Peptidyl-Threonine Phosphorylation (GO:0018107) Positive Regulation Of Microtubule Polymerization (GO:0031116) Positive Regulation Of Neuron Apoptotic Process (GO:0043525) Positive Regulation Of Protein Targeting To Membrane (GO:0090314) Regulation Of Actin Cytoskeleton Organization (GO:0032956) Regulation Of Dendritic Spine Morphogenesis (GO:0061001) Rhythmic Process (GO:0048511) Serine Phosphorylation Of STAT Protein (GO:0042501) Superior Olivary Nucleus Maturation (GO:0021722)
Molecular Function	Actin Filament Binding (GO:0051015) Alpha-Tubulin Binding (GO:0043014) Beta-Tubulin Binding (GO:0048487) Cadherin Binding (GO:0045296) Calcium Ion Binding (GO:0005509) Cyclin-Dependent Protein Serine/Threonine Kinase Activator Activity (GO:0061575) Ionotropic Glutamate Receptor Binding (GO:0035255) Kinase Activity (GO:0016301) Protease Binding (GO:0002020) Protein Kinase Binding (GO:0019901) Protein Serine/Threonine Kinase Activator Activity (GO:0043539)

Protein-Protein Interactions

Interactions with other proteins (4 interactors)

Partner (UniProt)		IntAct	Confidence score
Q9JLH6	Mitochondrial tRNA methylthiotransferase CDK5RAP1 (EC 2.8.4.3) (CDK5 activator-binding protein C42) (CDK5 regulatory subunit-associated protein 1) (mt-tRNA-2-methylthio-N6-dimethylallyladenosine synthase) (mt-tRNA-N6-(dimethylallyl)adenosine(37) methylthiotransferase)	EBI-307828	0.48
Q9JLH5	CDK5 regulatory subunit-associated protein 2 (CDK5 activator-binding protein C48)	EBI-307840	0.48
Q9JLH7	CDK5 regulatory subunit-associated protein 3 (CDK5 activator-binding protein C53)	EBI-307855	0.48
P15882	N-chimaerin (A-chimaerin) (Alpha-chimerin) (N-chimerin) (NC) (Rho GTPase-activating protein 2)	EBI-7146023	0.54

Cross-References

Database	Links
UNIPROT	Q28199 Q0II69 Q28865 Q29462
Pfam	PF03261

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK