NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Oxysterol-binding protein 1 - Mus musculus - NucEnvDB

Oxysterol-binding protein 1 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Oxysterol-binding protein 1
Accession Code	Q3B7Z2
Gene	Osbp
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 805)
MAATELRGVVGPGPAAIAAPGGGGAGPPAVGGGGGRGDAGPGPGVAAATAATAGGPGPGAGGVAAGGPGSAPPAAGSGGSGAGGSGSAREGWLFKWTNYIKGYQRRWFVLSNGLLSYYRSKAEMRHTCRG TINLATANITVEDSCNFIISNGGAQTYHLKASSEVERQRWVTALELAKAKAVKMLAESDDSGDEESVSQTDKTELQSTLRTLSSKVEDLSTCNDLIAKHGTALQRSLSELESLKLPAESNEKIKQVNERA TLFRITSNAMINACRDFLMLAQTHSKKWQKSLQYERDQRIRLEETLEQLAKQHNHLERAFRGATVLPANPPGSAGSGKDQCCSGKGDMSDEDDENEFFDAPEIITMPENLGHKRTGSNISGASSDVSLDE QYKHQLEETKKEKRTRIPYKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVAAFTVSSYSTTVFRTSKPFNPLLGETFELDRLEENGYRSICEQVSH HPPAAAHHAESKNGWTLRQEIKITSKFRGKYLSIMPLGTIHCIFHSTGHHYTWKKVTTTVHNIIVGKLWIDQSGEIDIVNHKTGDKCNLKFVPYSYFSRDVARKVTGEVTDPSGKVHFALLGTWDEKMDC FKVQAASGENGGDARQRGHEAEDSRVMLWKRNPLPKNAENMYYFSELALTLNAWEGGTAPTDSRLRPDQRLMENGRWDEANAEKQRLEEKQRLSRKKREAEAAKATEDGTPHDPYKALWFERKKDPVTRE LTHIYSGEYWECKEKQDWGSCPDIF

Subcellular Location

Description
Cytoplasm, cytosol {By SimilarityUniProtKB:P22059}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:P22059}. Golgi apparatus membrane {By SimilarityUniProtKB:P22059}; Peripheral membrane protein {By SimilarityUniProtKB:P22059}. Endoplasmic reticulum membrane {By SimilarityUniProtKB:P22059}; Peripheral membrane protein {By SimilarityUniProtKB:P22059}. Note=Predominantly cytosolic. {By SimilarityUniProtKB:P22059}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	By Similarity {ECO:0000250\|UniProtKB:P22059}
Assigned Ontology terms

Cellular Component	Cell Junction (GO:0030054) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Endoplasmic Reticulum Membrane (GO:0005789) Golgi Apparatus (GO:0005794) Golgi Membrane (GO:0000139) Intracellular Membrane-Bounded Organelle (GO:0043231) Membrane (GO:0016020) Nucleolus (GO:0005730) Nucleoplasm (GO:0005654) Perinuclear Endoplasmic Reticulum (GO:0097038) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Trans-Golgi Network (GO:0005802)

Biology & Function

Description
Lipid transporter involved in lipid countertransport between the Golgi complex and membranes of the endoplasmic reticulum: specifically exchanges sterol with phosphatidylinositol 4-phosphate (PI4P), delivering sterol to the Golgi in exchange for PI4P, which is degraded by the SAC1/SACM1L phosphatase in the endoplasmic reticulum. Binds cholesterol and a range of oxysterols including 25- hydroxycholesterol. Cholesterol binding promotes the formation of a complex with PP2A and a tyrosine phosphatase which dephosphorylates ERK1/2, whereas 25-hydroxycholesterol causes its disassembly. Regulates cholesterol efflux by decreasing ABCA1 stability. {By SimilarityUniProtKB:P22059}.
Assigned Ontology terms

Biological Process	Ceramide Transport (GO:0035627) Intracellular Cholesterol Transport (GO:0032367) Phospholipid Transport (GO:0015914) Positive Regulation Of Insulin Secretion Involved In Cellular Response To Glucose Stimulus (GO:0035774) Positive Regulation Of Secretory Granule Organization (GO:1904411) Positive Regulation Of Tyrosine Phosphorylation Of STAT Protein (GO:0042531) Sphingomyelin Biosynthetic Process (GO:0006686) Sterol Transport (GO:0015918)
Molecular Function	Phosphatidylinositol-4-Phosphate Binding (GO:0070273) Protein Domain Specific Binding (GO:0019904) Sterol Binding (GO:0032934) Sterol Transfer Activity (GO:0120015) Sterol Transporter Activity (GO:0015248)

Protein-Protein Interactions

Interactions with other proteins (1 interactors)

Partner (UniProt)		IntAct	Confidence score
A0A0F6B423	Deubiquitinase	EBI-27035120	0.46

Cross-References

Database	Links
UNIPROT	Q3B7Z2 E9QPD4 Q3V163 Q52KH7 Q570Y8
Pfam	PF01237 PF00169
PROSITE	PS01013 PS50003

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK