NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

PDZ and LIM domain protein 4 - Bos taurus - NucEnvDB

PDZ and LIM domain protein 4 (Bos taurus)

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

General Information

Protein Information
Protein Name	PDZ and LIM domain protein 4
Accession Code	Q3T005
Gene	PDLIM4
Organism	Bos taurus \| Cattle (Taxonomy: 9913)
Part of Reference Proteome?	Yes
Sequence (Length: 331)
MPHSVTLRGPSPWGFRLVGGRDFSVPLTISRVHAGSKAALAALCPGDLIQAINGESTELMTHLEAQNRIKGCRDHLTLSVSRPEGRSWPSTPEDNKAQAHRIHIDSEAQDGSPLTSRRPSATGLGPEDGR PGLGSPYGQSPRLPVPHNGSNSEATLLAQMGALHVSPPHSTDPARGLPRSRDCGVDLGSEVYRMLREPAEPAAAEPKQSGSFRYLQGMLEAGEGGERPGPGGPRNLKPTASKLGAPLSGLQGLPECTRCG HGIVGTIVKARDKLYHPECFMCSDCGLNLKQRGYFFLDERLYCESHAKARVKPPEGYDVVAVYPNAKVELV

Subcellular Location

Description
Cytoplasm, cytoskeleton {By SimilarityUniProtKB:P36202}. Cell projection, dendritic spine {By SimilarityUniProtKB:P36202}. Early endosome membrane {By SimilarityUniProtKB:P36202}; Peripheral membrane protein {By SimilarityUniProtKB:P36202}; Cytoplasmic side {By SimilarityUniProtKB:P36202}. Recycling endosome membrane {By SimilarityUniProtKB:P36202}; Peripheral membrane protein; Cytoplasmic side {By SimilarityUniProtKB:P36202}. Nucleus {ECO:0000250\|UniProtKB:P50479}. Cytoplasm, perinuclear region {ECO:0000250\|UniProtKB:P50479}. Cell projection, lamellipodium {ECO:0000250\|UniProtKB:P50479}. Synapse, synaptosome {By SimilarityUniProtKB:P36202}. Note=Localizes to actin stress fibers in nonmuscle cells. Colocalizes with GRIA1 in early endosomes. Enriched in numerous but not all spine-like structures along dendritic branches. Colocalizes with actin and enriched at sites containing larger amounts of actin and alpha-actinin. Targeted efficiently to spines via its PDZ domain-mediated interaction with the alpha-actinin/actin cytoskeletal complex. Localizes to synaptosomes in brain (By similarity). Colocalizes with F-actin. Colocalizes with TRIP6 at cell-cell contacts and lamellipodia. In the cytoplasm, displays a fibrillar pattern with characteristic thick fibers and occasional clusters. Colocalizes with the actin stress fibers. Oxidative stress induces redistribution from cytoskeleton to cytosol. Colocalizes with SRC at the perinuclear region, but not at focal adhesions (By similarity). {By SimilarityUniProtKB:P36202, ECO:0000250\|UniProtKB:P50479}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	By Similarity {ECO:0000250\|UniProtKB:P36202}
Assigned Ontology terms

Cellular Component	Adherens Junction (GO:0005912) Cytoplasm (GO:0005737) Cytoskeleton (GO:0005856) Dendritic Spine (GO:0043197) Early Endosome Lumen (GO:0031905) Early Endosome Membrane (GO:0031901) Filamentous Actin (GO:0031941) Lamellipodium (GO:0030027) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Postsynaptic Membrane (GO:0045211) Recycling Endosome Lumen (GO:0034777) Recycling Endosome Membrane (GO:0055038) Stress Fiber (GO:0001725) Z Disc (GO:0030018)

Biology & Function

Description
Suppresses SRC activation by recognizing and binding to active SRC and facilitating PTPN13-mediated dephosphorylation of SRC 'Tyr-419' leading to its inactivation. Inactivated SRC dissociates from this protein allowing the initiation of a new SRC inactivation cycle. Involved in reorganization of the actin cytoskeleton (By similarity). In nonmuscle cells, binds to ACTN1 (alpha-actinin-1), increases the affinity of ACTN1 to F-actin (filamentous actin), and promotes formation of actin stress fibers. Involved in regulation of the synaptic AMPA receptor transport in dendritic spines of hippocampal pyramidal neurons directing the receptors toward an insertion at the postsynaptic membrane. Links endosomal surface-internalized GRIA1- containing AMPA receptors to the alpha-actinin/actin cytoskeleton. Increases AMPA receptor-mediated excitatory postsynaptic currents in neurons (By similarity). {By SimilarityUniProtKB:P36202, By SimilarityUniProtKB:P50479}.
Assigned Ontology terms

Biological Process	Actin Cytoskeleton Organization (GO:0030036) Actin Cytoskeleton Reorganization (GO:0031532) Excitatory Chemical Synaptic Transmission (GO:0098976) Heart Development (GO:0007507) Muscle Structure Development (GO:0061061)
Molecular Function	Actin Binding (GO:0003779) Alpha-Actinin Binding (GO:0051393) Metal Ion Binding (GO:0046872) Muscle Alpha-Actinin Binding (GO:0051371) Protein Homodimerization Activity (GO:0042803) Protein Phosphatase Binding (GO:0019903)

Cross-References

Database	Links
UNIPROT	Q3T005
Pfam	PF15936 PF00412 PF00595
PROSITE	PS00478 PS50023 PS50106

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK