NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Zinc finger protein ZPR1 - Mus musculus - NucEnvDB

Zinc finger protein ZPR1 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Disease Associations Interactions Cross-References

General Information

Protein Information
Protein Name	Zinc finger protein ZPR1
Accession Code	Q62384
Gene	Zpr1
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 459)
MSASGAVQPGHPGAAVGPSPAAAASPATGPLFRPLSAEDEEQQPTEIESLCMNCYRNGTTRLLLTKIPFFREIIVSSFSC EHCGWNNTEIQSAGRIQDQGVRYTLTVRSQEDMNREVVKTDSATTRIPELDFEIPAFSQKGALTTVEGLISRAISGLEQD QPTRRAVEGAIAERIDEFIGKLKDLKQMASPFTLVIDDPSGNSFVENPHAPQKDNALVITYYDRTPQQAEMLGLQAEAPE EKAEEEDLRNEVLQFNTNCPECNAPAQTNMKLVQIPHFKEVIIMATNCENCGHRTNEVKSGGAVEPLGTRITLHITDPSD MTRDLLKSETCSVEIPELEFELGMAVLGGKFTTLEGLLKDIRELVTKNPFTLGDSSNPDQSEKLQEFSQKLGQIIEGKMK AHFIMNDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGYEAGLAPQR

Structure Viewer (PDB: 2QKD)

Subcellular Location

Description
Nucleus. Cytoplasm. Nucleus, nucleolus. Cytoplasm, perinuclear region {By Similarity}. Nucleus, gem. Nucleus, Cajal body. Cell projection, axon. Cell projection, growth cone. Note=Localized predominantly in the cytoplasm in serum-starved cells growth arrested in G0 of the mitotic cell cycle. Localized both in the nucleus and cytoplasm at the G1 phase of the mitotic cell cycle. Accumulates in the subnuclear bodies during progression into the S phase of the mitotic cell cycle. Diffusely localized throughout the cell during mitosis. Colocalized with NPAT and SMN1 in nuclear bodies including gems (Gemini of coiled bodies) and Cajal bodies in a cell cycle-dependent manner. Colocalized with EGFR in the cytoplasm of quiescent cells. Translocates from the cytoplasm to the nucleus in a epidermal growth factor (EGF)-dependent manner (By similarity). Translocates together with EEF1A1 from the cytoplasm to the nucleolus after treatment with mitogens. Colocalized with SMN1 in Gemini of coiled bodies (gems), Cajal bodies, axon and growth cones of neurons. {By Similarity}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Axon (GO:0030424) Cajal Body (GO:0015030) Cytoplasm (GO:0005737) Gemini Of Coiled Bodies (GO:0097504) Growth Cone (GO:0030426) Neuronal Cell Body (GO:0043025) Nucleolus (GO:0005730) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perikaryon (GO:0043204) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Acts as a signaling molecule that communicates proliferative growth signals from the cytoplasm to the nucleus. It is involved in the positive regulation of cell cycle progression (By similarity). Plays a role for the localization and accumulation of the survival motor neuron protein SMN1 in sub-nuclear bodies, including gems and Cajal bodies. Induces neuron differentiation and stimulates axonal growth and formation of growth cone in spinal cord motor neurons. Plays a role in the splicing of cellular pre-mRNAs. May be involved in H(2)O(2)-induced neuronal cell death. {By SimilarityUniProtKB:O75312, Experimental EvidencePubMed:15767679, Experimental EvidencePubMed:16648254, Experimental EvidencePubMed:22422766, Experimental EvidencePubMed:8650580}.
Assigned Ontology terms

Biological Process	Apoptotic Process Involved In Development (GO:1902742) Axon Development (GO:0061564) Cajal Body Organization (GO:0030576) Cell Population Proliferation (GO:0008283) Cellular Response To Epidermal Growth Factor Stimulus (GO:0071364) DNA Endoreduplication (GO:0042023) Inner Cell Mass Cell Proliferation (GO:0001833) Microtubule Cytoskeleton Organization (GO:0000226) MRNA Processing (GO:0006397) Negative Regulation Of Motor Neuron Apoptotic Process (GO:2000672) Positive Regulation Of Cell Cycle (GO:0045787) Positive Regulation Of Gene Expression (GO:0010628) Positive Regulation Of Growth (GO:0045927) Positive Regulation Of Protein Import Into Nucleus (GO:0042307) Positive Regulation Of RNA Splicing (GO:0033120) Positive Regulation Of Transcription Involved In G1/S Transition Of Mitotic Cell Cycle (GO:0071931) Pre-MRNA Catabolic Process (GO:1990261) Regulation Of Myelination (GO:0031641) RNA Splicing (GO:0008380) Spinal Cord Development (GO:0021510) Trophectodermal Cell Proliferation (GO:0001834)
Molecular Function	Receptor Tyrosine Kinase Binding (GO:0030971) Translation Initiation Factor Binding (GO:0031369) Zinc Ion Binding (GO:0008270)

Disease associations

Description
Note=May contribute to the severity of spinal muscular atrophy by increasing spinal motor neurons degeneration. {Experimental EvidencePubMed:16648254}.
Database Associations
OMIM
DisGeNET

Protein-Protein Interactions

Interactions with other proteins (4 interactors)

Partner (UniProt)		IntAct	Confidence score
P35282	Ras-related protein Rab-21 (Rab-12)	EBI-11566657	0.35
P35294	Ras-related protein Rab-19	EBI-11567325	0.35
P62821	Ras-related protein Rab-1A (EC 3.6.5.2) (YPT1-related protein)	EBI-11568013	0.35
P02994	Elongation factor 1-alpha (EF-1-alpha) (Eukaryotic elongation factor 1A) (eEF1A) (Translation elongation factor 1A)	EBI-15652651	0.56

Cross-References

Database	Links
UNIPROT	Q62384
PDB	2QKD
Pfam	PF03367

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK