NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Gamma-synuclein - Rattus norvegicus - NucEnvDB

Gamma-synuclein (Rattus norvegicus)

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

General Information

Protein Information
Protein Name	Gamma-synuclein
Accession Code	Q63544
Gene	Sncg
Organism	Rattus norvegicus \| Norway rat (Taxonomy: 10116)
Part of Reference Proteome?	Yes
Sequence (Length: 123)
MDVFKKGFSIAREGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKGERGTSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEEGEEAKSGGD

Subcellular Location

Description
Cytoplasm, perinuclear region {By Similarity}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {By Similarity}. Cytoplasm, cytoskeleton, spindle {By Similarity}. Note=Associated with centrosomes in several interphase cells. In mitotic cells, localized to the poles of the spindle (By similarity). {By Similarity}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Axon (GO:0030424) Axon Terminus (GO:0043679) Cytoplasm (GO:0005737) Microtubule Organizing Center (GO:0005815) Neuronal Cell Body (GO:0043025) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Spindle (GO:0005819) Synapse (GO:0045202)

Biology & Function

Description
Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway (By similarity). {By Similarity}.
Assigned Ontology terms

Biological Process	Adult Locomotory Behavior (GO:0008344) Aggressive Behavior (GO:0002118) Cellular Response To Hydrostatic Pressure (GO:0071464) Chemical Synaptic Transmission (GO:0007268) Negative Regulation Of Neuron Death (GO:1901215) Peripheral Nervous System Development (GO:0007422) Protein Secretion (GO:0009306) Regulation Of Dopamine Secretion (GO:0014059) Regulation Of Neuron Death (GO:1901214) Regulation Of Neurotransmitter Secretion (GO:0046928) Response To Cocaine (GO:0042220) Response To Desipramine (GO:1904307) Response To Xenobiotic Stimulus (GO:0009410) Synapse Organization (GO:0050808) Synaptic Vesicle Endocytosis (GO:0048488)
Molecular Function	Alpha-Tubulin Binding (GO:0043014) Beta-Tubulin Binding (GO:0048487) Cuprous Ion Binding (GO:1903136)

Cross-References

Database	Links
UNIPROT	Q63544 Q6R2I0
Pfam	PF01387

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK