NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Serine/threonine-protein kinase BRSK2 - Mus musculus - NucEnvDB

Serine/threonine-protein kinase BRSK2 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

General Information

Protein Information
Protein Name	Serine/threonine-protein kinase BRSK2
Accession Code	Q69Z98
Gene	Brsk2
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 735)
MTSTGKDGGGAQHAQYVGPYRLEKTLGKGQTGLVKLGIHCVTCQKVAIKIVNREKLSESVLMKVEREIAILKLIEHPHVL KLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQIISALDFCHSHSICHRDLKPENLLLDERNNIRIAD FGMASLQVGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRQLLEKVKRGVFHMPHFI PPDCQSLLRGMIEVDAARRLTLEHIQKHIWYIGGKNEPEPEQPIPRKVQIRSLPSLEDIDPDVLDSMHSLGCFRDRNKLL QDLLSEEENQEKMIYFLLLDRKERYPSHEDEDLPPRNEIDPPRKRVDSPMLNRHGKRRPERKSMEVLSVTDGGSPVPARR AIEMAQHGQRSRSISGASSGLSTSPLSSPRVTPHPSPRGSPLPTPKGTPVHTPKESPAGTPNPTPPSSPSVGGVPWRTRL NSIKNSFLGSPRFHRRKLQVPTPEEMSNLTPESSPELAKKSWFGNFINLEKEEQIFVVIKDKPLSSIKADIVHAFLSIPS LSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTHDQ PSAQHLSDTTNCMEVMTGRLSKCGTPLSNFFDVIKQLFSDEKNGQAAQAPSTPAKRSAHGPLGDSAAAGPGGDTEYPMGK DMAKMGPPAARREQP

Structure Viewer (PDB: 4YOM)

Subcellular Location

Description
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {By Similarity}. Cytoplasm, perinuclear region {By Similarity}. Endoplasmic reticulum {By Similarity}. Note=Detected at centrosomes during mitosis. Localizes to the endoplasmic reticulum in response to stress caused by tunicamycin (By similarity). {By Similarity}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Centrosome (GO:0005813) Cytoplasm (GO:0005737) Distal Axon (GO:0150034) Endoplasmic Reticulum (GO:0005783) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Serine/threonine-protein kinase that plays a key role in polarization of neurons and axonogenesis, cell cycle progress and insulin secretion. Phosphorylates CDK16, CDC25C, MAPT/TAU, PAK1 and WEE1. Following phosphorylation and activation by STK11/LKB1, acts as a key regulator of polarization of cortical neurons, probably by mediating phosphorylation of microtubule-associated proteins such as MAPT/TAU at 'Thr-504' and 'Ser-554'. Also regulates neuron polarization by mediating phosphorylation of WEE1 at 'Ser-642' in post-mitotic neurons, leading to down-regulate WEE1 activity in polarized neurons. Plays a role in the regulation of the mitotic cell cycle progress and the onset of mitosis. Plays a role in the regulation of insulin secretion in response to elevated glucose levels, probably via phosphorylation of CDK16 and PAK1. While BRSK2 phosphorylated at Thr- 175 can inhibit insulin secretion (PubMed:22798068), BRSK2 phosphorylated at Thr-261 can promote insulin secretion (PubMed:22669945). Regulates reorganization of the actin cytoskeleton. May play a role in the apoptotic response triggered by endoplasmic reticulum (ER) stress. {Experimental EvidencePubMed:15705853, Experimental EvidencePubMed:17482548, Experimental EvidencePubMed:20026642, Experimental EvidencePubMed:22669945, Experimental EvidencePubMed:22798068}.
Assigned Ontology terms

Biological Process	Actin Cytoskeleton Reorganization (GO:0031532) Axonogenesis (GO:0007409) Cell Division (GO:0051301) Cellular Response To Glucose Starvation (GO:0042149) ERAD Pathway (GO:0036503) Establishment Of Cell Polarity (GO:0030010) Exocytosis (GO:0006887) G2/M Transition Of Mitotic Cell Cycle (GO:0000086) Intracellular Signal Transduction (GO:0035556) Intrinsic Apoptotic Signaling Pathway In Response To Endoplasmic Reticulum Stress (GO:0070059) Microtubule Cytoskeleton Organization Involved In Establishment Of Planar Polarity (GO:0090176) Neuron Differentiation (GO:0030182) Neuron Projection Morphogenesis (GO:0048812) Peptidyl-Serine Phosphorylation (GO:0018105) Protein Phosphorylation (GO:0006468) Regulation Of Axonogenesis (GO:0050770) Regulation Of Insulin Secretion Involved In Cellular Response To Glucose Stimulus (GO:0061178) Regulation Of Neuron Projection Development (GO:0010975)
Molecular Function	ATP Binding (GO:0005524) ATPase Binding (GO:0051117) Magnesium Ion Binding (GO:0000287) Protein Kinase Binding (GO:0019901) Protein Serine Kinase Activity (GO:0106310) Protein Serine/Threonine Kinase Activity (GO:0004674) Tau-Protein Kinase Activity (GO:0050321)

Cross-References

Database	Links
UNIPROT	Q69Z98 Q699J3 Q699J4 Q6DMN7 Q6PHM0
PDB	4YNZ 4YOM
Pfam	PF00069
PROSITE	PS00107 PS50011 PS00108

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK