NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

E3 ubiquitin-protein ligase SH3RF1 - Mus musculus - NucEnvDB

E3 ubiquitin-protein ligase SH3RF1 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	E3 ubiquitin-protein ligase SH3RF1
Accession Code	Q69ZI1
Gene	Sh3rf1
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 892)
MDESALLDLLECPVCLERLDASAKVLPCQHTFCKRCLLGIVGSRNELRCPECRTLVGSGVDELPSNILLVRLLDGIKQRPWKPGPGGGGGTTCTNTLRAQGSTVVNCGSKDLQSSQCGQQPRVQAWSPPV RGIPQLPCAKALYNYEGKEPGDLKFSKGDIIILRRQVDENWYHGEVSGVHGFFPTNFVQIIKPLPQPPPQCKALYDFEVKDKEADKDCLPFAKDDVLTVIRRVDENWAEGMLADKIGIFPISYVEFNSAA KQLIEWDKPPVPGVDTAECPSATAQSTSASKHPDTKKNTRKRHSFTSLTMANKSSQGSQNRHSMEISPPVLISSSNPTAAARISELSGLSCSAPSQVHISTTGLIVTPPPSSPVTTGPAFTFPSDVPYQA ALGSMNPPLPPPPLLAATVLASTPSGATAAVAAAAAAAAAAGMGPRPVMGSSEQIAHLRPQTRPSVYVAIYPYTPRKEDELELRKGEMFLVFERCQDGWYKGTSMHTSKIGVFPGNYVAPVTRAVTNASQ AKVSMSTAGQASRGVTMVSPSTAGGPTQKPQGNGVAGNPSVVPTAVVSAAHIQTSPQAKVLLHMSGQMTVNQARNAVRTVAAHSQERPTAAVTPIQVQNAACLGPASVGLPHHSLASQPLPPMAGPAAHG AAVSISRTNAPMACAAGASLASPNMTSAMLETEPSGRTVTILPGLPTSPESAASACGNSSAGKPDKDSKKEKKGLLKLLSGASTKRKPRVSPPASPTLDVELGAGEAPLQGAVGPELPLGGSHGRVGSCP TDGDGPVAAGTAALAQDAFHRKTSSLDSAVPIAPPPRQACSSLGPVMNEARPVVCERHRVVVSYPPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI

Subcellular Location

Description
Cytoplasm, perinuclear region {By SimilarityUniProtKB:Q71F54}. Cell projection, lamellipodium {Experimental EvidencePubMed:14504284, Experimental EvidencePubMed:22959435}. Golgi apparatus, trans-Golgi network {Experimental EvidencePubMed:14504284}. Note=Colocalizes, with AKT2 in lamellipodia. Colocalizes, with HERP1, in trans-Golgi network (By similarity). {ECO:0000250\|UniProtKB:Q7Z6J0, Experimental EvidencePubMed:14504284}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytosol (GO:0005829) Golgi Apparatus (GO:0005794) Lamellipodium (GO:0030027) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Has E3 ubiquitin-protein ligase activity. In the absence of an external substrate, it can catalyze self-ubiquitination. Stimulates ubiquitination of potassium channel KCNJ1, enhancing its dynamin- dependent and clathrin-independent endocytosis (By similarity). Acts as a scaffold protein that coordinates with MAPK8IP1/JIP1 in organizing different components of the JNK pathway, including RAC1 or RAC2, MAP3K11/MLK3 or MAP3K7/TAK1, MAP2K7/MKK7, MAPK8/JNK1 and/or MAPK9/JNK2 into a functional multiprotein complex to ensure the effective activation of the JNK signaling pathway. Regulates the differentiation of CD4(+) and CD8(+) T-cells and promotes T-helper 1 (Th1) cell differentiation. Regulates the activation of MAPK8/JNK1 and MAPK9/JNK2 in CD4(+) T-cells and the activation of MAPK8/JNK1 in CD8(+) T-cells (PubMed:23963642, PubMed:27084103, PubMed:9482736). Plays a crucial role in the migration of neocortical neurons in the developing brain. Controls proper cortical neuronal migration and the formation of proximal cytoplasmic dilation in the leading process (PCDLP) in migratory neocortical neurons by regulating the proper localization of activated RAC1 and F-actin assembly (PubMed:22959435). {By SimilarityUniProtKB:Q7Z6J0, Experimental EvidencePubMed:22959435, Experimental EvidencePubMed:23963642, Experimental EvidencePubMed:27084103, Experimental EvidencePubMed:9482736}.
Assigned Ontology terms

Biological Process	Negative Regulation Of Apoptotic Process (GO:0043066) Negative Regulation Of Cysteine-Type Endopeptidase Activity Involved In Apoptotic Process (GO:0043154) Negative Regulation Of Extrinsic Apoptotic Signaling Pathway (GO:2001237) Neuron Migration (GO:0001764) Positive Regulation Of JNK Cascade (GO:0046330) Positive Regulation Of Proteasomal Ubiquitin-Dependent Protein Catabolic Process (GO:0032436) Protein Autoubiquitination (GO:0051865) Protein Ubiquitination (GO:0016567) Regulation Of CD4-Positive, Alpha-Beta T Cell Differentiation (GO:0043370) Regulation Of CD8-Positive, Alpha-Beta T Cell Proliferation (GO:2000564)
Molecular Function	MAP-Kinase Scaffold Activity (GO:0005078) Metal Ion Binding (GO:0046872) Ubiquitin Protein Ligase Activity (GO:0061630)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q9Z2F7	BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like	EBI-1774643	0.58
Interactions with other proteins (5 interactors)

Partner (UniProt)		IntAct	Confidence score
P61092	E3 ubiquitin-protein ligase SIAH1A (EC 2.3.2.27) (RING-type E3 ubiquitin transferase SIAH1A) (Seven in absentia homolog 1a) (Siah-1a) (Siah1a) (mSiah-1a)	EBI-957393	0.37
Q06985	E3 ubiquitin-protein ligase SIAH1B (EC 2.3.2.27) (RING-type E3 ubiquitin transferase SIAH1B) (Seven in absentia homolog 1b) (Siah-1b) (Siah1b)	EBI-957397	0.37
Q06986	E3 ubiquitin-protein ligase SIAH2 (EC 2.3.2.27) (RING-type E3 ubiquitin transferase SIAH2) (Seven in absentia homolog 2) (Siah-2) (mSiah2)	EBI-957425	0.37
Q8IUQ4	E3 ubiquitin-protein ligase SIAH1 (EC 2.3.2.27) (RING-type E3 ubiquitin transferase SIAH1) (Seven in absentia homolog 1) (Siah-1) (Siah-1a)	EBI-957438	0.54
P60953	Cell division control protein 42 homolog (EC 3.6.5.2) (G25K GTP-binding protein)	EBI-16881205	0.37

Cross-References

Database	Links
UNIPROT	Q69ZI1 O70254 Q3UG42 Q6P9M8 Q8BR66 Q8C2T5
Pfam	PF00018 PF14604
PROSITE	PS50002 PS00518 PS50089

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK