NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

All-trans retinoic acid-induced differentiation factor - Homo sapiens - NucEnvDB

All-trans retinoic acid-induced differentiation factor (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	All-trans retinoic acid-induced differentiation factor
Accession Code	Q6UW56
Gene	ATRAID
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 229)
MAPHDPGSLTTLVPWAAALLLALGVERALALPEICTQCPGSVQNLSKVAFYCKTTRELMLHARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNC PGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS

Subcellular Location

Description
Nucleus envelope {Experimental EvidencePubMed:21723284}. Cell membrane {Experimental EvidencePubMed:17524364}; Single-pass membrane protein {Experimental EvidencePubMed:17524364}. Note=Colocalizes with NELL1 on the nuclear envelope and the perinuclear region (PubMed:21723284).
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Intracellular Membrane-Bounded Organelle (GO:0043231) Lysosomal Membrane (GO:0005765) Nuclear Envelope (GO:0005635) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886)

Biology & Function

Description
Promotes osteoblast cell differentiation and terminal mineralization. Plays a role in inducing the cell cycle arrest via inhibiting CCND1 expression in all-trans-retinoic acid (ATRA) signal pathway. {Experimental EvidencePubMed:21723284}.
Assigned Ontology terms

Biological Process	Cell Differentiation (GO:0030154) Negative Regulation Of Osteoblast Proliferation (GO:0033689) Negative Regulation Of Protein Catabolic Process (GO:0042177) Positive Regulation Of Bone Mineralization (GO:0030501) Positive Regulation Of Osteoblast Differentiation (GO:0045669) Regulation Of Gene Expression (GO:0010468)
Molecular Function

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q92832	Protein kinase C-binding protein NELL1	EBI-7001256	0.61
Interactions with other proteins (7 interactors)

Partner (UniProt)		IntAct	Confidence score
Q93052	Lipoma-preferred partner (LIM domain-containing preferred translocation partner in lipoma)	EBI-736289	0.00
Q9Y5X1	Sorting nexin-9 (SH3 and PX domain-containing protein 1) (Protein SDP1) (SH3 and PX domain-containing protein 3A)	EBI-7876576	0.52
A0A6L8PDJ5	Alpha-ketoglutarate permease	EBI-2838097	0.00
Q00013	55 kDa erythrocyte membrane protein (p55) (Membrane protein, palmitoylated 1)	EBI-24627560	0.56
Q8NCC5	Sugar phosphate exchanger 3 (Solute carrier family 37 member 3)	EBI-21822465	0.35
Q16236	Nuclear factor erythroid 2-related factor 2 (NF-E2-related factor 2) (NFE2-related factor 2) (Nrf-2) (HEBP1) (Nuclear factor, erythroid derived 2, like 2)	EBI-22030894	0.35
Q14145	Kelch-like ECH-associated protein 1 (Cytosolic inhibitor of Nrf2) (INrf2) (Kelch-like protein 19)	EBI-22030903	0.35

Cross-References

Database	Links
UNIPROT	Q6UW56 A8C1S2 A8K779 Q96FF6 Q96RT2 Q9Y2R7 Q9Y5L7
PROSITE	PS00022 PS01186 PS50026
OMIM	619682
DisGeNET	51374

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK