NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Septin-14 - Homo sapiens - NucEnvDB

Septin-14 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Septin-14
Accession Code	Q6ZU15
Gene	SEPTIN14
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 432)
MAERTMAMPTQIPADGDTQKENNIRCLTTIGHFGFECLPNQLVSRSIRQGFTFNILCVGETGIGKSTLIDTLFNTNLKDNKSSHFYSNVGLQIQTYELQESNVQLKLTVVETVGYGDQIDKEASYQPIVD YIDAQFEAYLQEELKIKRSLFEYHDSRVHVCLYFISPTGHSLKSLDLLTMKNLDSKVNIIPLIAKADTISKNDLQTFKNKIMSELISNGIQIYQLPTDEETAAQANSSVSGLLPFAVVGSTDEVKVGKRM VRGRHYPWGVLQVENENHCDFVKLRDMLLCTNMENLKEKTHTQHYECYRYQKLQKMGFTDVGPNNQPVSFQEIFEAKRQEFYDQCQREEEELKQRFMQRVKEKEATFKEAEKELQDKFEHLKMIQQEEIR KLEEEKKQLEGEIIDFYKMKAASEALQTQLSTDTKKDKHRKK

Subcellular Location

Description
Cytoplasm {Experimental EvidencePubMed:17922164}. Cytoplasm, cytoskeleton {Experimental EvidencePubMed:17922164, Experimental EvidencePubMed:31450874}. Cell projection, axon {By SimilarityUniProtKB:Q9DA97}. Cell projection, dendrite {By SimilarityUniProtKB:Q9DA97}. Perikaryon {By SimilarityUniProtKB:Q9DA97}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:Q9DA97}. Cytoplasmic vesicle, secretory vesicle, acrosome {ECO:0000269\|PubMed:32249155}. Note=Colocalizes with actin stress fibers (PubMed:17922164). Expressed in the perinuclear rim and manchette structure in early elongating spermatids during spermiogenesis (By similarity). {By SimilarityUniProtKB:Q9DA97, Experimental EvidencePubMed:17922164}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Acrosomal Vesicle (GO:0001669) Axon (GO:0030424) Cell Division Site (GO:0032153) Cytoplasm (GO:0005737) Cytoskeleton (GO:0005856) Dendrite (GO:0030425) Microtubule Cytoskeleton (GO:0015630) Perikaryon (GO:0043204) Perinuclear Region Of Cytoplasm (GO:0048471) Septin Complex (GO:0031105) Septin Ring (GO:0005940)

Biology & Function

Description
Filament-forming cytoskeletal GTPase (Probable). Involved in the migration of cortical neurons and the formation of neuron leading processes during embryonic development (By similarity). Plays a role in sperm head formation during spermiogenesis, potentially via facilitating localization of ACTN4 to cell filaments (PubMed:33228246). {By SimilarityUniProtKB:Q9DA97, Experimental EvidencePubMed:33228246, Curator Inference}.
Assigned Ontology terms

Biological Process	Cytoskeleton-Dependent Cytokinesis (GO:0061640) Neuron Migration (GO:0001764) Protein Localization (GO:0008104) Protein Localization To Perinuclear Region Of Cytoplasm (GO:1905719) Spermatid Development (GO:0007286)
Molecular Function	GTP Binding (GO:0005525) GTPase Activity (GO:0003924) Molecular Adaptor Activity (GO:0060090)

Protein-Protein Interactions

Interactions with other proteins (17 interactors)

Partner (UniProt)		IntAct	Confidence score
Q9UHD8	Septin-9 (MLL septin-like fusion protein MSF-A) (MLL septin-like fusion protein) (Ovarian/Breast septin) (Ov/Br septin) (Septin D1)	EBI-2009321	0.54
Q8WYJ6	Septin-1 (LARP) (Peanut-like protein 3) (Serologically defined breast cancer antigen NY-BR-24)	EBI-2009333	0.37
Q15019	Septin-2 (Neural precursor cell expressed developmentally down-regulated protein 5) (NEDD-5)	EBI-2009337	0.37
Q9WU34	Neuronal-specific septin-3 (G-septin) (P40)	EBI-2009364	0.37
O43236	Septin-4 (Bradeion beta) (Brain protein H5) (CE5B3 beta) (Cell division control-related protein 2) (hCDCREL-2) (Peanut-like protein 2)	EBI-2009368	0.37
Q16181	Septin-7 (CDC10 protein homolog)	EBI-2009400	0.37
B3GNI6	Septin-11	EBI-2009411	0.37
Q4V8G5	Septin-12	EBI-2009423	0.37
Q96HA8	Protein N-terminal glutamine amidohydrolase (EC 3.5.1.122) (Protein NH2-terminal glutamine deamidase) (N-terminal Gln amidase) (Nt(Q)-amidase) (WDYHV motif-containing protein 1)	EBI-24521085	0.56
Q9H8Y8	Golgi reassembly-stacking protein 2 (GRS2) (Golgi phosphoprotein 6) (GOLPH6) (Golgi reassembly-stacking protein of 55 kDa) (GRASP55) (p59)	EBI-23727439	0.56
Q9BRG1	Vacuolar protein-sorting-associated protein 25 (hVps25) (Dermal papilla-derived protein 9) (ELL-associated protein of 20 kDa) (ESCRT-II complex subunit VPS25)	EBI-24554656	0.56
Q9H6L4	Armadillo repeat-containing protein 7	EBI-24557731	0.56
Q9H5Z6	Protein FAM124B	EBI-24588389	0.56
Q14141	Septin-6	EBI-21746554	0.35
Q9H3Q1	Cdc42 effector protein 4 (Binder of Rho GTPases 4)	EBI-21746903	0.35
Q9P0V9	Septin-10	EBI-21746988	0.35
Q9UH03	Neuronal-specific septin-3	EBI-21747031	0.35

Cross-References

Database	Links
UNIPROT	Q6ZU15 A6NCC2 B4DXD6
Pfam	PF00735
PROSITE	PS51719
OMIM	612140
DisGeNET	346288

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK