NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Cyclin-T2 - Mus musculus - NucEnvDB

Cyclin-T2 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Cyclin-T2
Accession Code	Q7TQK0
Gene	Ccnt2
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 723)
MASGRGASSRWFFTREQLENTPSRRCGVEADEELSHRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNRNIISPTALFLAAKVEEQARKLEHVIKVAHACLHPLEPLLDTKCDAYLQQTQ ELVLLETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVTLELLDELTHEFLQILEKTPSRLKRIRNWRAM AKKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPANPSFQKPSTSTFPAPIPLNSGSTSVQDSRASDNLSVLAAGMPSTSYSLSSHQEWPQHPDSARTDPVYTQKQEATLSGSQYISFQQGPSMALHSGL HHRPDKVADHSSAKQEYTHKAGSSKHHGPIPATPGMLPQKMSLDKYREKRKLETLDVDTRDHYLAAHAEQQHKHGPAQAVTGTSVTSPIKMKLPLTNSDRPEKHVAEKKERSGSLKLRIPIPPPDKGPSK EELKMKIKVASSERHSSSDEGSGKSKHSSPHISRDHKEKHKEHPANRHHSSHKYLHMHSGGSKHTADGMPPTVLRSPVGLGPEGVSSASSARKKLHSSEASHNHHSKMSKSSKSAGSSSSSSSVKQYLSS HSSVFNHPLPPPPPVTYQVGYGHLSTLVKLDKKPVEPHGPEANHEYSTSSQHMDYKDTFDMLDSLLSAQGMNM

Subcellular Location

Description
Cytoplasm, perinuclear region {Experimental EvidencePubMed:23060074}. Nucleus {Experimental EvidencePubMed:23060074}. Note=Nucleus in differentiating cells. {Experimental EvidencePubMed:23060074}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cyclin/CDK Positive Transcription Elongation Factor Complex (GO:0008024) Cytosol (GO:0005829) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886)

Biology & Function

Description
Regulatory subunit of the cyclin-dependent kinase pair (CDK9/cyclin T) complex, also called positive transcription elongation factor B (P-TEFB), which is proposed to facilitate the transition from abortive to production elongation by phosphorylating the CTD (carboxy- terminal domain) of the large subunit of RNA polymerase II (RNAP II). The activity of this complex is regulated by binding with 7SK snRNA (By similarity). Plays a role during muscle differentiation; P-TEFB complex interacts with MYOD1; this tripartite complex promotes the transcriptional activity of MYOD1 through its CDK9-mediated phosphorylation and binds the chromatin of promoters and enhancers of muscle-specific genes; this event correlates with hyperphosphorylation of the CTD domain of RNA pol II (PubMed:16245309, PubMed:23060074, PubMed:12037670). In addition, enhances MYOD1-dependent transcription through interaction with PKN1 (By similarity). Involved in early embryo development (PubMed:19364821). {By SimilarityUniProtKB:O60583, Experimental EvidencePubMed:12037670, Experimental EvidencePubMed:16245309, Experimental EvidencePubMed:19364821, Experimental EvidencePubMed:23060074}.
Assigned Ontology terms

Biological Process	Cell Cycle (GO:0007049) Cell Division (GO:0051301) DNA-Templated Transcription (GO:0006351) Early Viral Transcription (GO:0019085) Late Viral Transcription (GO:0019086) Phosphorylation Of RNA Polymerase II C-Terminal Domain Serine 2 Residues Involved In Positive Regulation Of Transcription Elongation From RNA Polymerase II Promoter (GO:1903655) Phosphorylation Of RNA Polymerase II C-Terminal Domain Serine 5 Residues Involved In Positive Regulation Of Transcription Elongation From RNA Polymerase II Promoter (GO:1903654) Positive Regulation Of DNA-Templated Transcription, Elongation (GO:0032786) Positive Regulation Of Transcription By RNA Polymerase II (GO:0045944) Positive Regulation Of Transcription Elongation By RNA Polymerase II (GO:0032968) Protein Phosphorylation (GO:0006468) Regulation Of Muscle Cell Differentiation (GO:0051147) Regulation Of Transcription By RNA Polymerase II (GO:0006357) Skeletal Muscle Tissue Development (GO:0007519)
Molecular Function	7SK SnRNA Binding (GO:0097322) Chromatin Binding (GO:0003682) Cyclin-Dependent Protein Serine/Threonine Kinase Activator Activity (GO:0061575) Cyclin-Dependent Protein Serine/Threonine Kinase Regulator Activity (GO:0016538) Protein Kinase Binding (GO:0019901) RNA Polymerase Binding (GO:0070063) Transcription Coactivator Binding (GO:0001223)

Protein-Protein Interactions

Interactions with other proteins (1 interactors)

Partner (UniProt)		IntAct	Confidence score
Q99J95	Cyclin-dependent kinase 9 (EC 2.7.11.22) (EC 2.7.11.23) (Cell division protein kinase 9)	EBI-6260872	0.35

Cross-References

Database	Links
UNIPROT	Q7TQK0 K4N0L9 K4N2S3
Pfam	PF00134

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK