NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Hypoxia-inducible factor 1-alpha inhibitor - Mus musculus - NucEnvDB

Hypoxia-inducible factor 1-alpha inhibitor (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Hypoxia-inducible factor 1-alpha inhibitor
Accession Code	Q8BLR9
Gene	Hif1an
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 349)
MAATAAEVAASGSGEAREEAEAPGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMGNFQNFKPRSNREEIKFHEFVE KLQAIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGHKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFRNVVG YETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN

Subcellular Location

Description
Nucleus {By SimilarityUniProtKB:Q9NWT6}. Cytoplasm {By SimilarityUniProtKB:Q9NWT6}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:Q9NWT6}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Cytosol (GO:0005829) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Hydroxylates HIF-1 alpha at 'Asn-799' in the C-terminal transactivation domain (CAD). Functions as an oxygen sensor and, under normoxic conditions, the hydroxylation prevents interaction of HIF-1 with transcriptional coactivators including Cbp/p300-interacting transactivator. Involved in transcriptional repression through interaction with HIF1A, VHL and histone deacetylases. Hydroxylates specific Asn residues within ankyrin repeat domains (ARD) of NFKB1, NFKBIA, NOTCH1, ASB4, PPP1R12A and several other ARD-containing proteins. Also hydroxylates Asp and His residues within ARDs of ANK1 and TNKS2, respectively. Negatively regulates NOTCH1 activity, accelerating myogenic differentiation (By similarity). Positively regulates ASB4 activity, promoting vascular differentiation. {By SimilarityUniProtKB:Q9NWT6, Experimental EvidencePubMed:17636018}.
Assigned Ontology terms

Biological Process	Negative Regulation Of Notch Signaling Pathway (GO:0045746) Negative Regulation Of Transcription From RNA Polymerase II Promoter In Response To Hypoxia (GO:0061428) Obsolete Peptidyl-Asparagine Hydroxylation (GO:0042265) Peptidyl-Aspartic Acid Hydroxylation (GO:0042264) Peptidyl-Histidine Hydroxylation (GO:0036138) Positive Regulation Of Myoblast Differentiation (GO:0045663)
Molecular Function	2-Oxoglutarate-Dependent Dioxygenase Activity (GO:0016706) Ankyrin Repeat Binding (GO:0071532) Carboxylic Acid Binding (GO:0031406) Ferrous Iron Binding (GO:0008198) NF-KappaB Binding (GO:0051059) Notch Binding (GO:0005112) [Protein]-Asparagine 3-Dioxygenase Activity (GO:0036140) Peptidyl-Histidine Dioxygenase Activity (GO:0036139) Protein Homodimerization Activity (GO:0042803) Zinc Ion Binding (GO:0008270)

Protein-Protein Interactions

Interactions with other proteins (2 interactors)

Partner (UniProt)		IntAct	Confidence score
Q07279	Transcription factor NF-E2 45 kDa subunit (Leucine zipper protein NF-E2) (Nuclear factor, erythroid-derived 2 45 kDa subunit) (p45 NF-E2)	EBI-26677785	0.37
Q8VIM5	Myocardin (Basic SAP coiled-coil transcription activator 2) (SRF cofactor protein)	EBI-26677793	0.37

Cross-References

Database	Links
UNIPROT	Q8BLR9 A1L3B7 Q3U3G4
Pfam	PF13621
PROSITE	PS51184

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK