NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Antizyme inhibitor 2 - Mus musculus - NucEnvDB

Antizyme inhibitor 2 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Antizyme inhibitor 2
Accession Code	Q8BVM4
Gene	Azin2
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 459)
MAGYLSESDFVMVEEGFSTRDLLEELTLGASQATSGKVAAFFVADLGAVVRKHFCFLKHLPRVRPFYAVGCNSSLGVLKVLAELGLGFSCANKAEMELVQHIGVPASKIICANPCKQVAQIKYAAKHGVR LLSFDNEVELAKVVKSHPSAKMVLCIATQDSHSLNHLSLRFGASLKSCRHLLENAKKSHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFQMGEELGHTMNILDLGGGFPGLEGAKVRFEEMASVINSAL DLYFPEGCGVDILAELGRYYVTSAFTVAVSIVAKREVLDQASREEQTGAAPKSIVYYLDEGVYGVFNSVLFDNTCPTPALQKKPSADQPLYSSSLWGPAVEGCDCVAEGLWLPQLQVGDWLVFDNMGAYT VDTKSLLGGTQARRVTYAMSRLAWEALRGQLLPAEEDQDAEGVCKPLSCGWEITDTLCVGPVFTPASIM

Subcellular Location

Description
Nucleus. Cytoplasm. Cytoplasm, perinuclear region {By Similarity}. Membrane. Cytoplasmic vesicle {By Similarity}. Endoplasmic reticulum-Golgi intermediate compartment. Golgi apparatus, cis-Golgi network. Golgi apparatus, trans-Golgi network {By Similarity}. Cytoplasmic granule. Cell projection, axon {By Similarity}. Cell projection, dendrite {By Similarity}. Perikaryon {By Similarity}. Note=Detected as vesicle-like pattern in neurite outgrowths. Localizes to the vesicular compartments of the secretory pathway, predominantly in the trans-Golgi network (TGN). Localizes with vesicle-associated membrane protein VAMP8 in the vicinity of the plasma membrane within serotonin-containing secretory granules (By similarity). Colocalizes with KDEL receptors in ER-Golgi intermediate compartment (ERGIC). Translocates from the ERGIC structure to the cytoplasm in a antizyme- dependent manner. Localizes with vesicle-associated membrane protein VAMP8 in the vicinity of the plasma membrane within serotonin- containing secretory granules. {By Similarity}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Axon (GO:0030424) Cis-Golgi Network (GO:0005801) Cytoplasm (GO:0005737) Cytoplasmic Vesicle (GO:0031410) Cytosol (GO:0005829) Dendrite (GO:0030425) Endoplasmic Reticulum-Golgi Intermediate Compartment Membrane (GO:0033116) Granular Vesicle (GO:1990005) Mitochondrion (GO:0005739) Nucleus (GO:0005634) Perikaryon (GO:0043204) Perinuclear Region Of Cytoplasm (GO:0048471) Trans-Golgi Network (GO:0005802) Transport Vesicle (GO:0030133)

Biology & Function

Description
Antizyme inhibitor (AZI) protein that positively regulates ornithine decarboxylase (ODC) activity and polyamine uptake. AZI is an enzymatically inactive ODC homolog that counteracts the negative effect of ODC antizymes (AZs) OAZ1, OAZ2 and OAZ3 on ODC activity by competing with ODC for antizyme-binding (PubMed:18062773, PubMed:18508777, PubMed:18973822). Inhibits antizyme-dependent ODC degradation and releases ODC monomers from their inactive complex with antizymes, leading to formation of the catalytically active ODC homodimer and restoring polyamine production (PubMed:16916800, PubMed:24967154). Participates in the morphological integrity of the trans-Golgi network (TGN) and functions as a regulator of intracellular secretory vesicle trafficking (By similarity). {By SimilarityUniProtKB:Q96A70, Experimental EvidencePubMed:16916800, Experimental EvidencePubMed:18062773, Experimental EvidencePubMed:18508777, Experimental EvidencePubMed:18973822, Experimental EvidencePubMed:24967154}.
Assigned Ontology terms

Biological Process	Negative Regulation Of Protein Catabolic Process (GO:0042177) Ornithine Metabolic Process (GO:0006591) Positive Regulation Of Catalytic Activity (GO:0043085) Positive Regulation Of Polyamine Transmembrane Transport (GO:1902269) Putrescine Biosynthetic Process From Ornithine (GO:0033387) Trans-Golgi Network Membrane Organization (GO:0098629)
Molecular Function	Catalytic Activity (GO:0003824) Ornithine Decarboxylase Activator Activity (GO:0042978)

Protein-Protein Interactions

Interactions with other proteins (3 interactors)

Partner (UniProt)		IntAct	Confidence score
Q9R109	Ornithine decarboxylase antizyme 3 (AZ3) (ODC-Az 3) (OAZ-t)	EBI-9656867	0.59
P54369	Ornithine decarboxylase antizyme 1 (ODC-Az)	EBI-9660716	0.40
O08608	Ornithine decarboxylase antizyme 2 (AZ2) (ODC-Az 2) (Seizure-related protein 15)	EBI-9660680	0.40

Cross-References

Database	Links
UNIPROT	Q8BVM4 A2A823
Pfam	PF02784 PF00278
PROSITE	PS00879

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK