NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 - Mus musculus - NucEnvDB

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

General Information

Protein Information
Protein Name	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1
Accession Code	Q8K4D7
Gene	Plcz1
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 647)
MESQLHELAEARWFLSKVQDDFRGGKINVEITHKLLEKLDFPCHFAHVKHIFKENDRQNQGRITIEEFRAIYRCIVHREEITEIFNTYTENRKILSENSLIEFLTQEQYEMEIDHSDSVEIINKYEPIEE VKGERQMSIEGFARYMFSSECLLFKENCKTVYQDMNHPLSDYFISSSHNTYLISDQILGPSDIWGYVSALVKGCRCLEIDCWDGSQNEPIVYHGYTFTSKLLFKTVVQAINKYAFVTSDYPVVLSLENHC SPGQQEVMASILQSTFGDFLLSDMLEEFPDTLPSPEALKFKILVKNRKVGTLSETHERIGTDKSGQVLEWKEVIYEDGDEDSGMDPETWDVFLSRIKEEREADPSTLSGIAGVKKRKRKMKIAMALSDLV IYTKAEKFRNFQYSRVYQQFNETNSIGESRARKLSKLRVHEFIFHTAAFITRVYPKMMRADSSNFNPQEFWNVGCQMVALNFQTPGLPMDLQNGKFLDNGGSGYILKPDILRDTTLGFNPNEPEYDDHPV TLTIRIISGIQLPVSSSSNTPDIVVIIEVYGVPNDHVKQQTRVVKNNAFSPKWNETFTFLIQVPELALIRFVVETQQGLLSGNELLGQYTLPVLCMNKGYRRVPLFSKSGANLEPSSLFIYVWYFRE

Subcellular Location

Description
Nucleus {Experimental EvidencePubMed:14701816, Experimental EvidencePubMed:15159452, Experimental EvidencePubMed:15385165, Experimental EvidencePubMed:15809052, Experimental EvidencePubMed:18322275}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:14701816, Experimental EvidencePubMed:15159452, Experimental EvidencePubMed:15385165, Experimental EvidencePubMed:15809052, Experimental EvidencePubMed:18322275}. Note=Exhibits alternative cytoplasmic/nuclear localization during development. Translocates from the pronucleus into cytoplasm upon nuclear envelope breakdown for mitosis and localizes again to the pronuclei at interphase following meiosis and mitosis. {Experimental EvidencePubMed:14701816, Experimental EvidencePubMed:15159452, Experimental EvidencePubMed:15385165, Experimental EvidencePubMed:15809052, Experimental EvidencePubMed:18322275}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Cytosol (GO:0005829) Nucleolus (GO:0005730) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Pronucleus (GO:0045120) Sperm Head (GO:0061827)

Biology & Function

Description
The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. In vitro, hydrolyzes PtdIns(4,5)P2 in a Ca(2+)-dependent manner. Triggers intracellular Ca(2+) oscillations in oocytes solely during M phase and is involved in inducing oocyte activation and initiating embryonic development up to the blastocyst stage. Is therefore a strong candidate for the egg-activating soluble sperm factor that is transferred from the sperm into the egg cytoplasm following gamete membrane fusion. May exert an inhibitory effect on phospholipase-C-coupled processes that depend on calcium ions and protein kinase C, including CFTR trafficking and function. {By SimilarityUniProtKB:Q86YW0, Experimental EvidencePubMed:12117804, Experimental EvidencePubMed:14701816, Experimental EvidencePubMed:15159452, Experimental EvidencePubMed:15385165, Experimental EvidencePubMed:15790568, Experimental EvidencePubMed:16000311, Experimental EvidencePubMed:16854985, Experimental EvidencePubMed:17933795, Experimental EvidencePubMed:18028898, Experimental EvidencePubMed:18322275}.
Assigned Ontology terms

Biological Process	Calcium Ion Transport (GO:0006816) Egg Activation (GO:0007343) Lipid Catabolic Process (GO:0016042) Phosphatidylinositol-Mediated Signaling (GO:0048015) Positive Regulation Of Cytosolic Calcium Ion Concentration (GO:0007204) Positive Regulation Of Cytosolic Calcium Ion Concentration Involved In Egg Activation (GO:0060470)
Molecular Function	Calcium Ion Binding (GO:0005509) Phosphatidylinositol Phospholipase C Activity (GO:0004435) Phosphatidylinositol-3-Phosphate Binding (GO:0032266) Phosphatidylinositol-4,5-Bisphosphate Binding (GO:0005546) Phosphatidylinositol-5-Phosphate Binding (GO:0010314) Phospholipase C Activity (GO:0004629)

Cross-References

Database	Links
UNIPROT	Q8K4D7 Q3KPE5
Pfam	PF00168 PF09279 PF00388 PF00387
PROSITE	PS50004 PS50222 PS50007 PS50008

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK