NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Ras-related protein Rab-7L1 - Mus musculus - NucEnvDB

Ras-related protein Rab-7L1 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Ras-related protein Rab-7L1
Accession Code	Q91YQ1
Gene	Rab29
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 204)
MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDSEMVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPSGEPVPCLLLANKSDLS PWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLVEKMMNNSREDVMSLSTQGNYINLQAKPSSGWTCC

Subcellular Location

Description
Cell membrane {Curator Inference}; Lipid-anchor {Curator Inference}; Cytoplasmic side {Curator Inference}. Cytoplasm {ECO:0000250\|UniProtKB:O14966}. Cytoplasm, perinuclear region {ECO:0000250\|UniProtKB:O14966}. Golgi apparatus {ECO:0000250\|UniProtKB:O14966}. Golgi apparatus, trans-Golgi network {ECO:0000250\|UniProtKB:O14966}. Cytoplasm, cytoskeleton {ECO:0000250\|UniProtKB:O14966}. Note=Colocalizes with GM130 at the Golgi apparatus (By similarity). Colocalizes with LRRK2 at dynamic tubules emerging from and retracting to the Golgi apparatus (By similarity). Colocalizes with TGN46 at the trans-Golgi network (TGN) (By similarity). {ECO:0000250\|UniProtKB:O14966, ECO:0000250\|UniProtKB:Q63481}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Lipid-Anchored	UniProt	By Similarity {ECO:0000250}
Assigned Ontology terms

Cellular Component	Cis-Golgi Network (GO:0005801) Cytoplasm (GO:0005737) Cytoskeleton (GO:0005856) Cytosol (GO:0005829) Early Endosome (GO:0005769) Golgi Apparatus (GO:0005794) Intracellular Membrane-Bounded Organelle (GO:0043231) Intracellular Vesicle (GO:0097708) Melanosome (GO:0042470) Mitochondrion (GO:0005739) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Recycling Endosome (GO:0055037) Trans-Golgi Network (GO:0005802) Vacuole (GO:0005773) Vesicle (GO:0031982)

Biology & Function

Description
The small GTPases Rab are key regulators in vesicle trafficking (By similarity). Essential for maintaining the integrity of endosome-trans-Golgi network structure (By similarity). Together with LRRK2, plays a role in the retrograde trafficking pathway for recycling proteins, such as mannose 6 phosphate receptor (M6PR), between lysosomes and the Golgi apparatus in a retromer-dependent manner (By similarity). Recruits LRRK2 to the Golgi apparatus and stimulates LRRK2 kinase activity (By similarity). Regulates also neuronal process morphology in the intact central nervous system (CNS) (By similarity). {By SimilarityUniProtKB:O14966, By SimilarityUniProtKB:Q63481}.
Assigned Ontology terms

Biological Process	Cell Differentiation (GO:0030154) Cilium Assembly (GO:0060271) Golgi Organization (GO:0007030) Intracellular Protein Transport (GO:0006886) Melanosome Organization (GO:0032438) Mitochondrion Organization (GO:0007005) Modulation By Host Of Viral Process (GO:0044788) Negative Regulation Of Neuron Projection Development (GO:0010977) Positive Regulation Of Intracellular Protein Transport (GO:0090316) Positive Regulation Of Receptor Recycling (GO:0001921) Positive Regulation Of T Cell Receptor Signaling Pathway (GO:0050862) Protein Localization To Ciliary Membrane (GO:1903441) Protein Localization To Membrane (GO:0072657) Regulation Of Neuron Death (GO:1901214) Regulation Of Retrograde Transport, Endosome To Golgi (GO:1905279) Response To Bacterium (GO:0009617) Retrograde Transport, Endosome To Golgi (GO:0042147) Synapse Assembly (GO:0007416) T Cell Activation (GO:0042110) Toxin Transport (GO:1901998)
Molecular Function	Dynein Complex Binding (GO:0070840) GDP Binding (GO:0019003) GTP Binding (GO:0005525) GTPase Activity (GO:0003924) Kinesin Binding (GO:0019894) Small GTPase Binding (GO:0031267)

Protein-Protein Interactions

Interactions with other proteins (2 interactors)

Partner (UniProt)		IntAct	Confidence score
Q5S007	Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin)	EBI-6514227	0.46
Q5S006	Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-)	EBI-6558874	0.46

Cross-References

Database	Links
UNIPROT	Q91YQ1
Pfam	PF00071
PROSITE	PS51419

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK