Signal-induced proliferation-associated protein 1 - Homo sapiens

Signal-induced proliferation-associated protein 1 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Signal-induced proliferation-associated protein 1
Accession Code	Q96FS4
Gene	SIPA1
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 1042)
MPMWAGGVGSPRRGMAPASTDDLFARKLRQPARPPLTPHTFEPRPVRGPLLRSGSDAGEARPPTPASPRARAHSHEEASRPAATSTRLFTDPLALLGLPAEEPEPAFPPVLEPRWFAHYDVQSLLFDWAP RSQGMGSHSEASSGTLASAEDQAASSDLLHGAPGFVCELGGEGELGLGGPASPPVPPALPNAAVSILEEPQNRTSAYSLEHADLGAGYYRKYFYGKEHQNFFGMDESLGPVAVSLRREEKEGSGGGTLHS YRVIVRTTQLRTLRGTISEDALPPGPPRGLSPRKLLEHVAPQLSPSCLRLGSASPKVPRTLLTLDEQVLSFQRKVGILYCRAGQGSEEEMYNNQEAGPAFMQFLTLLGDVVRLKGFESYRAQLDTKTDST GTHSLYTTYQDHEIMFHVSTMLPYTPNNQQQLLRKRHIGNDIVTIVFQEPGSKPFCPTTIRSHFQHVFLVVRAHTPCTPHTTYRVAVSRTQDTPAFGPALPAGGGPFAANADFRAFLLAKALNGEQAAGH ARQFHAMATRTRQQYLQDLATNEVTTTSLDSASRFGLPSLGGRRRAAPRGPGAELQAAGSLVWGVRAAPGARVAAGAQASGPEGIEVPCLLGISAEALVLVAPRDGRVVFNCACRDVLAWTFSEQQLDLY HGRGEAITLRFDGSPGQAVGEVVARLQLVSRGCETRELALPRDGQGRLGFEVDAEGFVTHVERFTFAETAGLRPGARLLRVCGQTLPSLRPEAAAQLLRSAPKVCVTVLPPDESGRPRRSFSELYTLSLQ EPSRRGAPDPVQDEVQGVTLLPTTKQLLHLCLQDGGSPPGPGDLAEERTEFLHSQNSLSPRSSLSDEAPVLPNTTPDLLLATTAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRASFLPRTLSLR NSISRIMSEAGSGTLEDEWQAISEIASTCNTILESLSREGQPIPESGDPKGTPKSDAEPEPGNLSEKVSHLESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAESESAATRLLLASKQLGSPTAD LA

Subcellular Location

Description
Nucleus {Experimental EvidencePubMed:9346962}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:9346962}. Endomembrane system; Peripheral membrane protein {Experimental EvidencePubMed:9346962}. Note=Mostly localized in the perinuclear membraneous region. {Experimental EvidencePubMed:9346962}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	Experimental Evidence {ECO:0000269\|PubMed:9346962}
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Cytosol (GO:0005829) Membrane (GO:0016020) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Protein-Containing Complex (GO:0032991) Transport Vesicle (GO:0030133)

Biology & Function

Description
GTPase activator for the nuclear Ras-related regulatory proteins Rap1 and Rap2 in vitro, converting them to the putatively inactive GDP-bound state (PubMed:9346962). Affects cell cycle progression (By similarity). {By SimilarityUniProtKB:P46062, Experimental EvidencePubMed:9346962}.
Assigned Ontology terms

Biological Process	Activation Of GTPase Activity (GO:0090630) Adaptive Immune Response (GO:0002250) Cellular Response To Water Deprivation (GO:0042631) Cytoskeleton Organization (GO:0007010) Intracellular Signal Transduction (GO:0035556) Negative Regulation Of Cell Adhesion (GO:0007162) Negative Regulation Of Cell Cycle (GO:0045786) Negative Regulation Of Cell Growth (GO:0030308) Regulation Of Small GTPase Mediated Signal Transduction (GO:0051056) Signal Transduction (GO:0007165)
Molecular Function	GTPase Activator Activity (GO:0005096) Protein C-Terminus Binding (GO:0008022)

Protein-Protein Interactions

Interactions with other proteins (27 interactors)

Partner (UniProt)		IntAct	Confidence score
P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	EBI-3927642	0.51
O14640	Segment polarity protein dishevelled homolog DVL-1 (Dishevelled-1) (DSH homolog 1)	EBI-3928857	0.37
P02751	Fibronectin (FN) (Cold-insoluble globulin) (CIG) [Cleaved into: Anastellin; Ugl-Y1; Ugl-Y2; Ugl-Y3]	EBI-6285956	0.35
Q8R034	Anaphase-promoting complex subunit 13 (APC13) (Cyclosome subunit 13)	EBI-11003686	0.35
Q9NQW6	Anillin	EBI-11009421	0.35
O00159	Unconventional myosin-Ic (Myosin I beta) (MMI-beta) (MMIb)	EBI-11030803	0.35
Q96H55	Unconventional myosin-XIX (Myosin head domain-containing protein 1)	EBI-11031416	0.35
P60710	Actin, cytoplasmic 1 (Beta-actin) (EC 3.6.4.-) [Cleaved into: Actin, cytoplasmic 1, N-terminally processed]	EBI-11045267	0.35
Q9UHB6	LIM domain and actin-binding protein 1 (Epithelial protein lost in neoplasm)	EBI-11058729	0.35
Q9D6P8	Calmodulin-like protein 3	EBI-11062262	0.35
Q16643	Drebrin (Developmentally-regulated brain protein)	EBI-11080402	0.35
Q8VDD5	Myosin-9 (Cellular myosin heavy chain, type A) (Myosin heavy chain 9) (Myosin heavy chain, non-muscle IIa) (Non-muscle myosin heavy chain A) (NMMHC-A) (Non-muscle myosin heavy chain IIa) (NMMHC II-a) (NMMHC-IIA)	EBI-11092730	0.35
P35579	Myosin-9 (Cellular myosin heavy chain, type A) (Myosin heavy chain 9) (Myosin heavy chain, non-muscle IIa) (Non-muscle myosin heavy chain A) (NMMHC-A) (Non-muscle myosin heavy chain IIa) (NMMHC II-a) (NMMHC-IIA)	EBI-11098811	0.35
P47755	F-actin-capping protein subunit alpha-2 (CapZ alpha-2)	EBI-11117728	0.35
P46940	Ras GTPase-activating-like protein IQGAP1 (p195)	EBI-11132927	0.35
P62140	Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PP-1B) (PPP1CD) (EC 3.1.3.16) (EC 3.1.3.53)	EBI-11142496	0.35
P56945	Breast cancer anti-estrogen resistance protein 1 (CRK-associated substrate) (Cas scaffolding protein family member 1) (p130cas)	EBI-15099687	0.35
P27348	14-3-3 protein theta (14-3-3 protein T-cell) (14-3-3 protein tau) (Protein HS1)	EBI-21902679	0.35
P31946	14-3-3 protein beta/alpha (Protein 1054) (Protein kinase C inhibitor protein 1) (KCIP-1) [Cleaved into: 14-3-3 protein beta/alpha, N-terminally processed]	EBI-21903886	0.35
P61981	14-3-3 protein gamma (Protein kinase C inhibitor protein 1) (KCIP-1) [Cleaved into: 14-3-3 protein gamma, N-terminally processed]	EBI-21905461	0.35
Q04917	14-3-3 protein eta (Protein AS1)	EBI-21907689	0.35
P63104	14-3-3 protein zeta/delta (Protein kinase C inhibitor protein 1) (KCIP-1)	EBI-21909838	0.35
O68690	Putative type III secretion protein (Type III secretion protein) (Type III secretion spans bacterial envelope protein) (Yop proteins translocation protein G homolog)	EBI-20817631	0.37
P14404	Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog)	EBI-21026252	0.35
Q9BYB0	SH3 and multiple ankyrin repeat domains protein 3 (Shank3) (Proline-rich synapse-associated protein 2) (ProSAP2)	EBI-26514894	0.37
P61964	WD repeat-containing protein 5 (BMP2-induced 3-kb gene protein)	EBI-30845695	0.44
P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	EBI-34581889	0.35

Cross-References

Database	Links
UNIPROT	Q96FS4 O14518 O60484 O60618 Q2YD83
Pfam	PF00595 PF02145
PROSITE	PS50106 PS50085
OMIM	602180
DisGeNET	6494

NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Signal-induced proliferation-associated protein 1 (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description

Assigned Ontology terms

Protein-Protein Interactions

Interactions with other proteins (27 interactors)

Cross-References

Database

Links

Signal-induced proliferation-associated protein 1 (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with other proteins (27 interactors)

Cross-References

Database

Links

Description

Description