NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

RNA transcription, translation and transport factor protein - Mus musculus - NucEnvDB

RNA transcription, translation and transport factor protein (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	RNA transcription, translation and transport factor protein
Accession Code	Q9CQE8
Gene	RTRAF
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 244)
MFRRKLTALDYHNPSGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLKDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNRKNTDNAAKNAEPLINLDVNNPDF KAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALEKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR

Subcellular Location

Description
Nucleus {By SimilarityUniProtKB:Q9Y224}. Cytoplasm, cytosol {By SimilarityUniProtKB:Q9Y224}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:Q9Y224}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {By SimilarityUniProtKB:Q9Y224}. Note=May localize at the centrosome during mitosis. Shuttles between the cytosol and the nucleus: enters into the nucleus in case of active transcription while it accumulates in cytosol when transcription level is low (By similarity). {ECO:0000250}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Centrosome (GO:0005813) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Mitotic Spindle (GO:0072686) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) TRNA-Splicing Ligase Complex (GO:0072669)

Biology & Function

Description
RNA-binding protein involved in modulation of mRNA transcription by Polymerase II. Component of the tRNA-splicing ligase complex and is required for tRNA ligation. May be required for RNA transport. {By SimilarityUniProtKB:Q9Y224}.
Assigned Ontology terms

Biological Process	Negative Regulation Of Protein Kinase Activity (GO:0006469) Positive Regulation Of Transcription By RNA Polymerase II (GO:0045944) TRNA Splicing, Via Endonucleolytic Cleavage And Ligation (GO:0006388)
Molecular Function	Identical Protein Binding (GO:0042802) RNA Binding (GO:0003723) RNA Polymerase II Complex Binding (GO:0000993)

Protein-Protein Interactions

Interactions with other proteins (6 interactors)

Partner (UniProt)		IntAct	Confidence score
P62158	Calmodulin-1	EBI-911456	0.35
Q923J1	Transient receptor potential cation channel subfamily M member 7 (EC 2.7.11.1) (Channel-kinase 1) (Long transient receptor potential channel 7) (LTrpC-7) (LTrpC7) (Transient receptor potential-phospholipase C-interacting kinase) (TRP-PLIK)	EBI-9661302	0.35
P14094	Sodium/potassium-transporting ATPase subunit beta-1 (Sodium/potassium-dependent ATPase subunit beta-1)	EBI-20566937	0.35
P07602	Prosaposin (Proactivator polypeptide) [Cleaved into: Saposin-A (Protein A); Saposin-B-Val; Saposin-B (Cerebroside sulfate activator) (CSAct) (Dispersin) (Sphingolipid activator protein 1) (SAP-1) (Sulfatide/GM1 activator); Saposin-C (A1 activator) (Co-beta-glucosidase) (Glucosylceramidase activator) (Sphingolipid activator protein 2) (SAP-2); Saposin-D (Component C) (Protein C)]	EBI-21347829	0.35
Q6NZM9	Histone deacetylase 4 (HD4) (EC 3.5.1.98)	EBI-26472137	0.35
Q8VI24	DNA-binding protein SATB2 (Special AT-rich sequence-binding protein 2)	EBI-26885060	0.35

Cross-References

Database	Links
UNIPROT	Q9CQE8
Pfam	PF10036

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK