NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Synaptojanin-2-binding protein - Mus musculus - NucEnvDB

Synaptojanin-2-binding protein (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Synaptojanin-2-binding protein
Accession Code	Q9D6K5
Gene	Synj2bp
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 145)
MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKEDGAAAQDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGCAVSLRVQHRLPVQNGPIVHRGEGEPSGVPVAMVLLPVFAL TMVAVWAFVRYRKQL

Subcellular Location

Description
Mitochondrion outer membrane {By SimilarityUniProtKB:Q9WVJ4}; Single-pass type IV membrane protein {By SimilarityUniProtKB:Q9WVJ4}; Cytoplasmic side {By SimilarityUniProtKB:Q9WVJ4}. Cytoplasm, perinuclear region {ECO:0000269\|PubMed:11882656}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Basolateral Plasma Membrane (GO:0016323) Cell Junction (GO:0030054) Cell Surface (GO:0009986) Obsolete Integral Component Of Mitochondrial Outer Membrane (GO:0031307) Mitochondrial Outer Membrane (GO:0005741) Mitochondrion (GO:0005739) Neuromuscular Junction (GO:0031594) Neuron Projection (GO:0043005) Perinuclear Region Of Cytoplasm (GO:0048471) Postsynaptic Density Membrane (GO:0098839)

Biology & Function

Description
Isoform 1 regulates endocytosis of activin type 2 receptor kinases through the Ral/RALBP1-dependent pathway and may be involved in suppression of activin-induced signal transduction. Isoform 2 and isoform 3 show a stimulatory affect on activin-induced signal transduction and enhance activin type 2 expression at the cell surface. {Experimental EvidencePubMed:11882656, Experimental EvidencePubMed:16648306}.
Assigned Ontology terms

Biological Process	Cell-Cell Adhesion (GO:0098609) Chemical Synaptic Transmission (GO:0007268) Cytoplasm Organization (GO:0007028) Endocytosis (GO:0006897) Establishment Or Maintenance Of Epithelial Cell Apical/Basal Polarity (GO:0045197) Intracellular Distribution Of Mitochondria (GO:0048312) Negative Regulation Of Activin Receptor Signaling Pathway (GO:0032926) Negative Regulation Of Angiogenesis (GO:0016525) Negative Regulation Of Endothelial Cell Migration (GO:0010596) Negative Regulation Of Endothelial Cell Proliferation (GO:0001937) Negative Regulation Of ERK1 And ERK2 Cascade (GO:0070373) Negative Regulation Of Sprouting Angiogenesis (GO:1903671) Positive Regulation Of Activin Receptor Signaling Pathway (GO:0032927) Positive Regulation Of Protein Localization To Cell Surface (GO:2000010) Positive Regulation Of Receptor Internalization (GO:0002092) Protein Targeting (GO:0006605) Receptor Clustering (GO:0043113) Receptor Localization To Synapse (GO:0097120) Regulation Of Endocytosis (GO:0030100) Regulation Of Notch Signaling Pathway (GO:0008593) Rho Protein Signal Transduction (GO:0007266)
Molecular Function	Protein C-Terminus Binding (GO:0008022) Type II Activin Receptor Binding (GO:0070699)

Protein-Protein Interactions

Interactions with other proteins (4 interactors)

Partner (UniProt)		IntAct	Confidence score
A2ARV4	Low-density lipoprotein receptor-related protein 2 (LRP-2) (Glycoprotein 330) (gp330) (Megalin)	EBI-300919	0.51
Q91ZX7	Prolow-density lipoprotein receptor-related protein 1 (LRP-1) (Alpha-2-macroglobulin receptor) (A2MR) (CD antigen CD91) [Cleaved into: Low-density lipoprotein receptor-related protein 1 85 kDa subunit (LRP-85); Low-density lipoprotein receptor-related protein 1 515 kDa subunit (LRP-515); Low-density lipoprotein receptor-related protein 1 intracellular domain (LRPICD)]	EBI-301424	0.40
Q61483	Delta-like protein 1 (Drosophila Delta homolog 1) (Delta1) [Cleaved into: Dll1-soluble form (Dll1-EC) (Shed form); Dll1-derived cell-associated form (Dll1-TMIC) (Membrane-associated fragment); Dll1-intracellular form (Dll1-IC)]	EBI-11699888	0.37
Q9JI71	Delta-like protein 4 (Drosophila Delta homolog 4) (Delta4)	EBI-11699894	0.44

Cross-References

Database	Links
UNIPROT	Q9D6K5 Q2TTN6 Q6YNE6 Q78HT9 Q8K4F3 Q9D8G4
Pfam	PF00595
PROSITE	PS50106

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK