Casein kinase I isoform delta - Mus musculus

Casein kinase I isoform delta (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Casein kinase I isoform delta
Accession Code	Q9DC28
Gene	Csnk1d
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 415)
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIPTIRWCGAEGDYNVM VMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDAR THQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRAADDAERERRDREERLRHSRN PATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPVSGMERERKVSMRLHRGAPVNVSSSDLTGRQDTSRMSTSQI PGRVASSGLQSVVHR

Structure Viewer (PDB: 5X17)

Subcellular Location

Description
Cytoplasm {By Similarity}. Nucleus {Experimental EvidencePubMed:10848614, Experimental EvidencePubMed:17101137, Experimental EvidencePubMed:19414593}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {By Similarity}. Cytoplasm, perinuclear region {By Similarity}. Cell membrane {By Similarity}. Cytoplasm, cytoskeleton, spindle {By Similarity}. Golgi apparatus {By Similarity}. Note=Localized at mitotic spindle microtubules, and at the centrosomes and interphase in interphase cells. Recruited to the spindle apparatus and the centrosomes in response to DNA-damage. Correct subcellular localization requires kinase activity (By similarity). {By Similarity}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Centrosome (GO:0005813) Ciliary Basal Body (GO:0036064) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Golgi Apparatus (GO:0005794) Neuron Projection (GO:0043005) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Spindle (GO:0005819) Spindle Microtubule (GO:0005876)

Biology & Function

Description
Essential serine/threonine-protein kinase that regulates diverse cellular growth and survival processes including Wnt signaling, DNA repair and circadian rhythms. It can phosphorylate a large number of proteins. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. Phosphorylates connexin-43/GJA1, MAP1A, SNAPIN, MAPT/TAU, TOP2A, DCK, HIF1A, EIF6, p53/TP53, DVL2, DVL3, ESR1, AIB1/NCOA3, DNMT1, PKD2, YAP1, PER1 and PER2. Central component of the circadian clock. In balance with PP1, determines the circadian period length through the regulation of the speed and rhythmicity of PER1 and PER2 phosphorylation. Controls PER1 and PER2 nuclear transport and degradation. YAP1 phosphorylation promotes its SCF(beta-TRCP) E3 ubiquitin ligase-mediated ubiquitination and subsequent degradation. DNMT1 phosphorylation reduces its DNA-binding activity. Phosphorylation of ESR1 and AIB1/NCOA3 stimulates their activity and coactivation. Phosphorylation of DVL2 and DVL3 regulates WNT3A signaling pathway that controls neurite outgrowth. Phosphorylates NEDD9/HEF1 (PubMed:29191835). EIF6 phosphorylation promotes its nuclear export. Triggers down-regulation of dopamine receptors in the forebrain. Activates DCK in vitro by phosphorylation. TOP2A phosphorylation favors DNA cleavable complex formation. May regulate the formation of the mitotic spindle apparatus in extravillous trophoblast. Modulates connexin-43/GJA1 gap junction assembly by phosphorylation. Probably involved in lymphocyte physiology. Regulates fast synaptic transmission mediated by glutamate. {Experimental EvidencePubMed:10848614, Experimental EvidencePubMed:16014721, Experimental EvidencePubMed:17101137, Experimental EvidencePubMed:19414593, Experimental EvidencePubMed:19948962, Experimental EvidencePubMed:20145109, Experimental EvidencePubMed:20192920, Experimental EvidencePubMed:20421981, Experimental EvidencePubMed:21930935, Experimental EvidencePubMed:29191835}.
Assigned Ontology terms

Biological Process	Circadian Regulation Of Gene Expression (GO:0032922) Golgi Organization (GO:0007030) Microtubule Nucleation (GO:0007020) Non-Motile Cilium Assembly (GO:1905515) Peptidyl-Serine Phosphorylation (GO:0018105) Positive Regulation Of Canonical Wnt Signaling Pathway (GO:0090263) Positive Regulation Of Non-Canonical Wnt Signaling Pathway (GO:2000052) Positive Regulation Of Proteasomal Ubiquitin-Dependent Protein Catabolic Process (GO:0032436) Positive Regulation Of Protein Phosphorylation (GO:0001934) Positive Regulation Of Wnt Signaling Pathway (GO:0030177) Positive Regulation Of Wnt-Mediated Midbrain Dopaminergic Neuron Differentiation (GO:1905426) Protein Localization To Centrosome (GO:0071539) Protein Localization To Cilium (GO:0061512) Protein Localization To Golgi Apparatus (GO:0034067) Protein Phosphorylation (GO:0006468) Regulation Of Circadian Rhythm (GO:0042752) Signal Transduction (GO:0007165) Spindle Assembly (GO:0051225) Wnt Signaling Pathway (GO:0016055)
Molecular Function	ATP Binding (GO:0005524) Kinase Activity (GO:0016301) Protein Kinase Activity (GO:0004672) Protein Serine Kinase Activity (GO:0106310) Protein Serine/Threonine Kinase Activity (GO:0004674) Tau-Protein Kinase Activity (GO:0050321)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (2 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
O54943	Period circadian protein homolog 2	EBI-15900328	0.40
Q5U651	Ras-interacting protein 1	EBI-11075774	0.35
Interactions with other proteins (19 interactors)

Partner (UniProt)		IntAct	Confidence score
Q7TN08	Dapper homolog 2 (mDpr2) (Dapper antagonist of catenin 2)	EBI-6392514	0.40
Q0PHV7	Dapper homolog 3 (Dapper antagonist of catenin 3)	EBI-6392534	0.40
P35813	Protein phosphatase 1A (EC 3.1.3.16) (Protein phosphatase 2C isoform alpha) (PP2C-alpha) (Protein phosphatase IA)	EBI-11075774	0.35
Q8WUZ0	B-cell CLL/lymphoma 7 protein family member C	EBI-11075774	0.35
Q96K37	Solute carrier family 35 member E1	EBI-11075774	0.35
P49674	Casein kinase I isoform epsilon (CKI-epsilon) (CKIe) (EC 2.7.11.1)	EBI-11075774	0.35
O15534	Period circadian protein homolog 1 (hPER1) (Circadian clock protein PERIOD 1) (Circadian pacemaker protein Rigui)	EBI-11075774	0.35
Q8NG31	Kinetochore scaffold 1 (ALL1-fused gene from chromosome 15q14 protein) (AF15q14) (Bub-linking kinetochore protein) (Blinkin) (Cancer susceptibility candidate gene 5 protein) (Cancer/testis antigen 29) (CT29) (Kinetochore-null protein 1) (Protein CASC5) (Protein D40/AF15q14)	EBI-11075774	0.35
Q15651	High mobility group nucleosome-binding domain-containing protein 3 (Thyroid receptor-interacting protein 7) (TR-interacting protein 7) (TRIP-7)	EBI-11075774	0.35
P13861	cAMP-dependent protein kinase type II-alpha regulatory subunit	EBI-11075774	0.35
O75382	Tripartite motif-containing protein 3 (Brain-expressed RING finger protein) (RING finger protein 22) (RING finger protein 97)	EBI-11075774	0.35
O00308	NEDD4-like E3 ubiquitin-protein ligase WWP2 (EC 2.3.2.26) (Atrophin-1-interacting protein 2) (AIP2) (HECT-type E3 ubiquitin transferase WWP2) (WW domain-containing protein 2)	EBI-11075774	0.35
Q6ZRV2	Protein FAM83H	EBI-11075774	0.35
Q14C86	GTPase-activating protein and VPS9 domain-containing protein 1 (GAPex-5) (Rab5-activating protein 6)	EBI-11075774	0.35
P56199	Integrin alpha-1 (CD49 antigen-like family member A) (Laminin and collagen receptor) (VLA-1) (CD antigen CD49a)	EBI-11075774	0.35
Q6YHK3	CD109 antigen (150 kDa TGF-beta-1-binding protein) (C3 and PZP-like alpha-2-macroglobulin domain-containing protein 7) (Platelet-specific Gov antigen) (p180) (r150) (CD antigen CD109)	EBI-11075774	0.35
Q9Y343	Sorting nexin-24	EBI-11075774	0.35
O35973	Period circadian protein homolog 1 (mPER1) (Circadian clock protein PERIOD 1) (Circadian pacemaker protein Rigui)	EBI-15900175	0.40
Q3UL36	Arginine and glutamate-rich protein 1	EBI-26888124	0.35

Cross-References

Database	Links
UNIPROT	Q9DC28 Q3TZK2 Q99KK4
PDB	4JJR 5X17
Pfam	PF00069
PROSITE	PS00107 PS50011 PS00108

Casein kinase I isoform delta (Mus musculus)

General Information

Protein Information

Structure Viewer (PDB: 5X17)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (2 interactors)

Interactions with other proteins (19 interactors)

Cross-References

Database

Links

Description

Description