NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Apoptosis regulator Bcl-2 - Cricetulus griseus - NucEnvDB

Apoptosis regulator Bcl-2 (Cricetulus griseus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Apoptosis regulator Bcl-2
Accession Code	Q9JJV8
Gene	BCL2
Organism	Cricetulus griseus \| Chinese hamster (Taxonomy: 10029)
Part of Reference Proteome?	No
Sequence (Length: 236)
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDVGDVDAAPLGAAPTPGIFSFQPESNPTPAVHRDMAARTSPLRPIVATTGPTLSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATV VEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSVRPLFDFSWLSLKTLLSLALVGACITLGTYLGHK

Subcellular Location

Description
Mitochondrion outer membrane {By SimilarityUniProtKB:P10415}; Single-pass membrane protein {Sequence Analysis}. Nucleus membrane {By SimilarityUniProtKB:P10415}; Single- pass membrane protein {Sequence Analysis}. Endoplasmic reticulum membrane {By SimilarityUniProtKB:P10415}; Single-pass membrane protein {Sequence Analysis}. Cytoplasm {ECO:0000250\|UniProtKB:P10417}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Cytosol (GO:0005829) Endoplasmic Reticulum Membrane (GO:0005789) Mitochondrial Outer Membrane (GO:0005741) Myelin Sheath (GO:0043209) Nuclear Membrane (GO:0031965) Nucleoplasm (GO:0005654) Pore Complex (GO:0046930)

Biology & Function

Description
Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). Also acts as an inhibitor of autophagy: interacts with BECN1 and AMBRA1 during non-starvation conditions and inhibits their autophagy function. May attenuate inflammation by impairing NLRP1- inflammasome activation, hence CASP1 activation and IL1B release. {By SimilarityUniProtKB:P10415}.
Assigned Ontology terms

Biological Process	Actin Filament Organization (GO:0007015) Axon Regeneration (GO:0031103) Axonogenesis (GO:0007409) B Cell Apoptotic Process (GO:0001783) B Cell Homeostasis (GO:0001782) B Cell Lineage Commitment (GO:0002326) B Cell Proliferation (GO:0042100) B Cell Receptor Signaling Pathway (GO:0050853) Behavioral Fear Response (GO:0001662) Branching Involved In Ureteric Bud Morphogenesis (GO:0001658) Calcium Ion Transport Into Cytosol (GO:0060402) CD8-Positive, Alpha-Beta T Cell Lineage Commitment (GO:0043375) Cell-Cell Adhesion (GO:0098609) Cellular Response To Glucose Starvation (GO:0042149) Cellular Response To Hypoxia (GO:0071456) Cellular Response To Organic Substance (GO:0071310) Cochlear Nucleus Development (GO:0021747) Defense Response To Virus (GO:0051607) Dendritic Cell Apoptotic Process (GO:0097048) Digestive Tract Morphogenesis (GO:0048546) Ear Development (GO:0043583) Endoplasmic Reticulum Calcium Ion Homeostasis (GO:0032469) Epithelial Cell Apoptotic Process (GO:1904019) Extrinsic Apoptotic Signaling Pathway In Absence Of Ligand (GO:0097192) Extrinsic Apoptotic Signaling Pathway Via Death Domain Receptors (GO:0008625) Focal Adhesion Assembly (GO:0048041) G1/S Transition Of Mitotic Cell Cycle (GO:0000082) Gland Morphogenesis (GO:0022612) Glomerulus Development (GO:0032835) Hair Follicle Morphogenesis (GO:0031069) Hematopoietic Stem Cell Differentiation (GO:0060218) Homeostasis Of Number Of Cells Within A Tissue (GO:0048873) Intrinsic Apoptotic Signaling Pathway In Response To DNA Damage (GO:0008630) Intrinsic Apoptotic Signaling Pathway In Response To Endoplasmic Reticulum Stress (GO:0070059) Intrinsic Apoptotic Signaling Pathway In Response To Oxidative Stress (GO:0008631) Lymphoid Progenitor Cell Differentiation (GO:0002320) Male Gonad Development (GO:0008584) Melanin Metabolic Process (GO:0006582) Melanocyte Differentiation (GO:0030318) Mesenchymal Cell Development (GO:0014031) Metanephros Development (GO:0001656) Motor Neuron Apoptotic Process (GO:0097049) Myeloid Cell Apoptotic Process (GO:0033028) Negative Regulation Of Anoikis (GO:2000811) Negative Regulation Of Autophagy (GO:0010507) Negative Regulation Of B Cell Apoptotic Process (GO:0002903) Negative Regulation Of Calcium Ion Transport Into Cytosol (GO:0010523) Negative Regulation Of Cell Growth (GO:0030308) Negative Regulation Of Cell Migration (GO:0030336) Negative Regulation Of Cellular PH Reduction (GO:0032848) Negative Regulation Of Dendritic Cell Apoptotic Process (GO:2000669) Negative Regulation Of Epithelial Cell Apoptotic Process (GO:1904036) Negative Regulation Of Extrinsic Apoptotic Signaling Pathway In Absence Of Ligand (GO:2001240) Negative Regulation Of G1/S Transition Of Mitotic Cell Cycle (GO:2000134) Negative Regulation Of Intrinsic Apoptotic Signaling Pathway (GO:2001243) Negative Regulation Of Motor Neuron Apoptotic Process (GO:2000672) Negative Regulation Of Myeloid Cell Apoptotic Process (GO:0033033) Negative Regulation Of Ossification (GO:0030279) Negative Regulation Of Osteoblast Proliferation (GO:0033689) Negative Regulation Of Reactive Oxygen Species Metabolic Process (GO:2000378) Negative Regulation Of Retinal Cell Programmed Cell Death (GO:0046671) Negative Regulation Of T Cell Apoptotic Process (GO:0070233) Neuron Maturation (GO:0042551) Oocyte Development (GO:0048599) Organ Growth (GO:0035265) Ossification (GO:0001503) Osteoblast Proliferation (GO:0033687) Ovarian Follicle Development (GO:0001541) Peptidyl-Serine Phosphorylation (GO:0018105) Peptidyl-Threonine Phosphorylation (GO:0018107) Pigment Granule Organization (GO:0048753) Positive Regulation Of B Cell Proliferation (GO:0030890) Positive Regulation Of Catalytic Activity (GO:0043085) Positive Regulation Of Cell Growth (GO:0030307) Positive Regulation Of Melanocyte Differentiation (GO:0045636) Positive Regulation Of Multicellular Organism Growth (GO:0040018) Positive Regulation Of Neuron Maturation (GO:0014042) Positive Regulation Of Peptidyl-Serine Phosphorylation (GO:0033138) Positive Regulation Of Skeletal Muscle Fiber Development (GO:0048743) Positive Regulation Of Smooth Muscle Cell Migration (GO:0014911) Post-Embryonic Development (GO:0009791) Protein Dephosphorylation (GO:0006470) Protein Polyubiquitination (GO:0000209) Reactive Oxygen Species Metabolic Process (GO:0072593) Regulation Of Cell-Matrix Adhesion (GO:0001952) Regulation Of Gene Expression (GO:0010468) Regulation Of Glycoprotein Biosynthetic Process (GO:0010559) Regulation Of Mitochondrial Membrane Permeability (GO:0046902) Regulation Of Mitochondrial Membrane Potential (GO:0051881) Regulation Of Nitrogen Utilization (GO:0006808) Regulation Of Protein Localization (GO:0032880) Regulation Of Protein Stability (GO:0031647) Regulation Of Transmembrane Transporter Activity (GO:0022898) Regulation Of Viral Genome Replication (GO:0045069) Release Of Cytochrome C From Mitochondria (GO:0001836) Renal System Process (GO:0003014) Response To Cytokine (GO:0034097) Response To Gamma Radiation (GO:0010332) Response To Glucocorticoid (GO:0051384) Response To Hydrogen Peroxide (GO:0042542) Response To Iron Ion (GO:0010039) Response To Ischemia (GO:0002931) Response To Kainic Acid (GO:1904373) Response To Nicotine (GO:0035094) Response To Toxic Substance (GO:0009636) Response To UV-B (GO:0010224) Response To Xenobiotic Stimulus (GO:0009410) Retinal Cell Programmed Cell Death (GO:0046666) Skeletal Muscle Fiber Development (GO:0048741) Smooth Muscle Cell Migration (GO:0014909) Spleen Development (GO:0048536) Stem Cell Development (GO:0048864) T Cell Apoptotic Process (GO:0070231) T Cell Differentiation In Thymus (GO:0033077) T Cell Homeostasis (GO:0043029) Thymus Development (GO:0048538)
Molecular Function	BH3 Domain Binding (GO:0051434) Channel Activity (GO:0015267) Channel Inhibitor Activity (GO:0016248) DNA-Binding Transcription Factor Binding (GO:0140297) Identical Protein Binding (GO:0042802) Protease Binding (GO:0002020) Protein Heterodimerization Activity (GO:0046982) Protein Phosphatase 2A Binding (GO:0051721) Sequence-Specific DNA Binding (GO:0043565) Ubiquitin Protein Ligase Binding (GO:0031625)

Protein-Protein Interactions

Interactions with other proteins (1 interactors)

Partner (UniProt)		IntAct	Confidence score
Q14790	Caspase-8 (CASP-8) (EC 3.4.22.61) (Apoptotic cysteine protease) (Apoptotic protease Mch-5) (CAP4) (FADD-homologous ICE/ced-3-like protease) (FADD-like ICE) (FLICE) (ICE-like apoptotic protease 5) (MORT1-associated ced-3 homolog) (MACH) [Cleaved into: Caspase-8 subunit p18; Caspase-8 subunit p10]	EBI-1749111	0.40

Cross-References

Database	Links
UNIPROT	Q9JJV8
Pfam	PF00452 PF02180
PROSITE	PS50062 PS01080 PS01258 PS01259 PS01260 PS50063

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK