NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Apoptosis-inducing factor 1, mitochondrial - Rattus norvegicus - NucEnvDB

Apoptosis-inducing factor 1, mitochondrial (Rattus norvegicus)

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

General Information

Protein Information
Protein Name	Apoptosis-inducing factor 1, mitochondrial
Accession Code	Q9JM53
Gene	Aifm1
Organism	Rattus norvegicus \| Norway rat (Taxonomy: 10116)
Part of Reference Proteome?	Yes
Sequence (Length: 612)
MFRCGGLAGAFKQKLVPLVRSVCVQRPKQRNRLPGNLFQQWRVPLELQMARQMASSGPSGGKMDNSVLVLIVGLSTIGAGAYAYKTIKEDQKRYNERIMGLGLSPEEKQRRAIASAAEGGSVPPIRVPSH VPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATG GTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPEYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGKLLIKLKDGRKVET DHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSAT EQSGTGIRSESETESEASEITIPPSDPAVPQVPVEGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED

Subcellular Location

Description
Mitochondrion intermembrane space {By SimilarityUniProtKB:Q9Z0X1}. Mitochondrion inner membrane {By SimilarityUniProtKB:Q9Z0X1}. Cytoplasm {By SimilarityUniProtKB:Q9Z0X1}. Nucleus {By SimilarityUniProtKB:Q9Z0X1}. Cytoplasm, perinuclear region {ECO:0000250\|UniProtKB:O95831}. Note=Proteolytic cleavage during or just after translocation into the mitochondrial intermembrane space (IMS) results in the formation of an inner-membrane-anchored mature form (AIFmit) (By similarity). During apoptosis, further proteolytic processing leads to a mature form, which is confined to the mitochondrial IMS in a soluble form (AIFsol) (By similarity). AIFsol is released to the cytoplasm in response to specific death signals, and translocated to the nucleus, where it induces nuclear apoptosis. Release into the cytoplasm is mediated upon binding to poly-ADP-ribose chains (By similarity). Translocation into the nucleus is promoted by interaction with (auto-poly-ADP-ribosylated) processed form of PARP1 (By similarity). Colocalizes with EIF3G in the nucleus and perinuclear region (By similarity). {ECO:0000250\|UniProtKB:O95831, By SimilarityUniProtKB:Q9Z0X1}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Cytosol (GO:0005829) Mitochondrial Inner Membrane (GO:0005743) Mitochondrial Intermembrane Space (GO:0005758) Mitochondrion (GO:0005739) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Functions both as NADH oxidoreductase and as regulator of apoptosis (By similarity). In response to apoptotic stimuli, it is released from the mitochondrion intermembrane space into the cytosol and to the nucleus, where it functions as a proapoptotic factor in a caspase-independent pathway. Release into the cytoplasm is mediated upon binding to poly-ADP-ribose chains. The soluble form (AIFsol) found in the nucleus induces 'parthanatos' i.e. caspase-independent fragmentation of chromosomal DNA. Binds to DNA in a sequence- independent manner (By similarity). Interacts with EIF3G, and thereby inhibits the EIF3 machinery and protein synthesis, and activates caspase-7 to amplify apoptosis (By similarity). Plays a critical role in caspase-independent, pyknotic cell death in hydrogen peroxide- exposed cells (By similarity). In contrast, participates in normal mitochondrial metabolism. Plays an important role in the regulation of respiratory chain biogenesis by interacting with CHCHD4 and controlling CHCHD4 mitochondrial import (By similarity). {By SimilarityUniProtKB:O95831, By SimilarityUniProtKB:Q9Z0X1}.
Assigned Ontology terms

Biological Process	Activation Of Cysteine-Type Endopeptidase Activity Involved In Apoptotic Process (GO:0006919) Apoptotic Process (GO:0006915) Cellular Response To Aldosterone (GO:1904045) Cellular Response To Estradiol Stimulus (GO:0071392) Cellular Response To Hydrogen Peroxide (GO:0070301) Cellular Response To Nitric Oxide (GO:0071732) Cellular Response To Oxygen-Glucose Deprivation (GO:0090650) Intrinsic Apoptotic Signaling Pathway In Response To Endoplasmic Reticulum Stress (GO:0070059) Mitochondrial Respiratory Chain Complex Assembly (GO:0033108) Mitochondrial Respiratory Chain Complex I Assembly (GO:0032981) Neuron Apoptotic Process (GO:0051402) Positive Regulation Of Cell Death (GO:0010942) Positive Regulation Of Necroptotic Process (GO:0060545) Positive Regulation Of Neuron Apoptotic Process (GO:0043525) Programmed Cell Death (GO:0012501) Protein Import Into Mitochondrial Intermembrane Space (GO:0045041) Regulation Of Apoptotic DNA Fragmentation (GO:1902510) Response To Ischemia (GO:0002931) Response To L-Glutamate (GO:1902065) Response To Toxic Substance (GO:0009636)
Molecular Function	DNA Binding (GO:0003677) FAD Binding (GO:0071949) NAD(P)H Oxidase H2O2-Forming Activity (GO:0016174) NADH Dehydrogenase Activity (GO:0003954) Oxidoreductase Activity, Acting On NAD(P)H (GO:0016651) Poly-ADP-D-Ribose Binding (GO:0072572) Protein Dimerization Activity (GO:0046983)

Cross-References

Database	Links
UNIPROT	Q9JM53 Q548E3
Pfam	PF14721 PF07992

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK