NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Exocyst complex component EXO84B - Arabidopsis thaliana - NucEnvDB

Exocyst complex component EXO84B (Arabidopsis thaliana)

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

General Information

Protein Information
Protein Name	Exocyst complex component EXO84B
Accession Code	Q9LTB0
Gene	EXO84B
Organism	Arabidopsis thaliana \| Thale cress (Taxonomy: 3702)
Part of Reference Proteome?	Yes
Sequence (Length: 752)
MAAKTARSKATPTKENGVRVEEGLSLFKSDKFDADAYVQSKCSINEKDIKQLCSYLLDLKRASAEEMRRSVYANYPAFIRTSKEISDLEGELSSIRNLLSTQATLIHGLADGVNIDDDKVSDESLANGLL NFEDNGLSDLEKWATEFPDHLDALLAERRVDEALAAFDEGEILVSQANEKHTLSSSVLSSLQFAIAERKQKLADQLAKAACQPSTRGGELRSAIAALKRLGDGPRAHTVLLDAHFQRYQYNMQSLRPSST SYGGAYTAALSQLVFSAISQASSDSLGIFGKEPAYSSELVTWATKQTEAFSLLVKRHALASSAAAGGLRAAAECAQIALGHCSLLEARGLSLCPVLLKHFKPIVEQALEANLKRIEENTAAMAAADDWVL TSPPAGSRHASTAFQNKLTSSAHRFNLMVQDFFEDVGPLLSMQLGSKALEGLFRVFNSYVDVLVRALPGSIEEEDPNFESSCNKIVQMAETEANQLALLANASLLADELLPRAAMKLSLDQTGQRTDDLR RPLDRQNRNPEQREWKRRLLSTVDKLKDAFCRQHALDLIFTEEGDSHLSADMYVNIDENGEDVDFFPSLIFQELFAKLNRMASLAADMFVGRERFAISLLMRLTETVILWLSGDQSFWDDIEEGPRPLGP LGLRQLYLDMKFVICFASQGRYLSRNLHRGTNEIISKALAAFTATGIDPYSELPEDDWFNDICVDAMERLSGKTKGNNGDVHSPTASVSAQSVSSARSHGSY

Subcellular Location

Description
Cytoplasm, cytosol {Experimental EvidencePubMed:19895414}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:19895414}. Cytoplasm, cytoskeleton, phragmoplast {Experimental EvidencePubMed:20870962}. Secreted, cell wall {Experimental EvidencePubMed:20870962}. Cell membrane {ECO:0000269\|PubMed:27803190}. Note=Localized to globular structures in the perinuclear region (PubMed:19895414). During cytokinesis, localizes to the nascent cell plate and later to the cell plate insertion site and along the post-cytokinetic wall (PubMed:20870962). Polarized localization at the outermost side of root epidermal and cap cells, in the outer lateral membrane domain facing the environment (PubMed:27803190). {Experimental EvidencePubMed:19895414, Experimental EvidencePubMed:20870962, ECO:0000269\|PubMed:27803190}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoskeleton (GO:0005856) Cytosol (GO:0005829) Exocyst (GO:0000145) Extracellular Region (GO:0005576) Perinuclear Region Of Cytoplasm (GO:0048471) Phragmoplast (GO:0009524) Plasma Membrane (GO:0005886)

Biology & Function

Description
Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion. Involved in polarized cell growth and organ morphogenesis. During cytokinesis, involved in cell plate initiation, cell plate maturation and formation of new primary cell wall. Probable component of an exocyst subcomplex specifically involved in autophagy-related, Golgi-independent membrane traffic to the vacuole. Regulates autophagosome formation and autophagy-related Golgi- independent import into the vacuole. Mediates ABCG36/PEN3 outer- membrane polarity at the periphery of lateral root cap and root epidermal cells (PubMed:27803190). {Experimental EvidencePubMed:20870962, Experimental EvidencePubMed:23944713, Experimental EvidencePubMed:27803190}.
Assigned Ontology terms

Biological Process	Exocytosis (GO:0006887) Golgi To Plasma Membrane Transport (GO:0006893) Protein Localization (GO:0008104) Protein Transport (GO:0015031)
Molecular Function

Cross-References

Database	Links
UNIPROT	Q9LTB0
Pfam	PF16528

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK