NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Mitotic-spindle organizing protein 1B - Arabidopsis thaliana - NucEnvDB

Mitotic-spindle organizing protein 1B (Arabidopsis thaliana)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Mitotic-spindle organizing protein 1B
Accession Code	Q9M0N8
Gene	GIP1
Organism	Arabidopsis thaliana \| Thale cress (Taxonomy: 3702)
Part of Reference Proteome?	Yes
Sequence (Length: 71)
MDEEASRTARESLELVFRMSNILDTGLDRHTLSVLIALCDLGVNPEALATVVKELRRESIPDSVTTTPSIH

Subcellular Location

Description
Cytoplasm, cytoskeleton, microtubule organizing center {By SimilarityUniProtKB:Q08AG7}. Cytoplasm, cytoskeleton, spindle. Nucleus. Cytoplasm, cytoskeleton, phragmoplast. Nucleus envelope. Note=Reorganized from the nucleus to the prospindle and the preprophase band in late G2. After nuclear envelope breakdown, localized on spindle and phragmoplast microtubules (MTs) and on the reforming nuclear envelope of daughter cells. Present in mitotic microtubule arrays. In interphase cortical arrays, gamma-tubulin complexes are preferentially recruited to existing microtubules, from which new microtubules are efficiently nucleated.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Gamma-Tubulin Complex (GO:0000930) Gamma-Tubulin Ring Complex (GO:0000931) Interphase Microtubule Organizing Center (GO:0031021) Kinetochore (GO:0000776) Kinetochore Microtubule (GO:0005828) Mitotic Spindle (GO:0072686) Nuclear Envelope (GO:0005635) Nuclear Outer Membrane (GO:0005640) Phragmoplast (GO:0009524) Preprophase Band (GO:0009574) Spindle (GO:0005819)

Biology & Function

Description
Required for gamma-tubulin complex recruitment to the microtubule organizing centers (MTOCs) (By similarity). During mitosis, modulates gamma-tubulin complex localization, spindle stability and chromosomal segregation. Necessary for gametophyte development and embryogenesis. {By Similarity}.
Assigned Ontology terms

Biological Process	CENP-A Containing Chromatin Assembly (GO:0034080) Centromere Complex Assembly (GO:0034508) Gamma-Tubulin Complex Localization (GO:0033566) Microtubule Cytoskeleton Organization (GO:0000226) Microtubule Nucleation By Interphase Microtubule Organizing Center (GO:0051415) Microtubule Nucleation By Microtubule Organizing Center (GO:0051418) Mitotic Spindle Assembly (GO:0090307) Mitotic Spindle Organization (GO:0007052)
Molecular Function	Histone Binding (GO:0042393)

Protein-Protein Interactions

Interactions with other proteins (1 interactors)

Partner (UniProt)		IntAct	Confidence score
P29512	Tubulin beta-2 chain	EBI-1573933	0.51

Cross-References

Database	Links
UNIPROT	Q9M0N8
Pfam	PF12554

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK