NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

UBX domain-containing protein 2 - Caenorhabditis elegans - NucEnvDB

UBX domain-containing protein 2 (Caenorhabditis elegans)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	UBX domain-containing protein 2
Accession Code	Q9N2W5
Gene	ubxn
Organism	Caenorhabditis elegans (Taxonomy: 6239)
Part of Reference Proteome?	Yes
Sequence (Length: 301)
MSRNIRTFRDIGNNDDGGPDSDDSGADAAERGAPQEFYAGSGQAVQGPRGAAARGPDSEAHIRRILQAAEVVQPEGGEAPRGRPSGRETISLTLHLWSDGLSIEDGPLMSRQDPRTIEFLESVGKGEIPP SLVQQYPGKEIDFKVNRHHEEYVAPKMKPFGGSGVRLGNVVPTVLGQSSSSATTAGTSSATTDHNPDHTAENEAKQLEDAKKELSTNMNEPTTNIQIRLPNNQRLVGIFNHSHTLEAVRTFICTARPDMI YAPFQMMAAYPPKPFEDESQTLKDANVLNSVVAVKILPTTN

Subcellular Location

Description
Cytoplasm, perinuclear region {Experimental EvidencePubMed:20977550}. Nucleus {Experimental EvidencePubMed:23649807}. Cytoplasm {Experimental EvidencePubMed:23649807}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {Experimental EvidencePubMed:23649807}. Note=Colocalizes with cdc-48.1 to the perinuclear region in spermatocytes (PubMed:20977550). Nuclear localization is cdc-48-dependent (PubMed:23649807). During embryonic mitotic metaphase, telophase and to a certain extent prophase, localizes to centrosomes (PubMed:23649807). {Experimental EvidencePubMed:20977550, Experimental EvidencePubMed:23649807}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Cytosol (GO:0005829) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Spindle Pole Centrosome (GO:0031616)

Biology & Function

Description
Ubiquitin-binding protein which acts as an adapter for ATPase cdc-48.1 and/or cdc-48.2, conferring substrate specificity (PubMed:20977550). Together with ubxn-2 and ubxn-3, plays a role in hermaphrodite spermatogenesis probably by promoting the degradation of sex determination terminal factor tra-1 (PubMed:20977550). Probably in association with ATPase cdc-48.1 or/and cdc-48.2, regulates the centrosomal levels of kinase air-1 levels during mitotic progression by promoting air-1 removal from centrosomes in prophase (PubMed:23649807). Also, regulates spindle orientation in the one-cell embryo by controlling centration and rotation of the pronuclei-centrosome complex in prophase (PubMed:23649807). {Experimental EvidencePubMed:20977550, Experimental EvidencePubMed:23649807}.
Assigned Ontology terms

Biological Process	Autophagosome Assembly (GO:0000045) Cell Differentiation (GO:0030154) Establishment Of Mitotic Spindle Orientation (GO:0000132) Golgi Organization (GO:0007030) Masculinization Of Hermaphroditic Germ-Line (GO:0042006) Membrane Fusion (GO:0061025) Negative Regulation Of Protein Localization To Centrosome (GO:1904780) Nuclear Membrane Reassembly (GO:0031468) Positive Regulation Of Protein Catabolic Process (GO:0045732) Proteasome-Mediated Ubiquitin-Dependent Protein Catabolic Process (GO:0043161) Spermatogenesis (GO:0007283)
Molecular Function	K48-Linked Polyubiquitin Modification-Dependent Protein Binding (GO:0036435) Protein Kinase Binding (GO:0019901) Ubiquitin Binding (GO:0043130)

Protein-Protein Interactions

Interactions with other proteins (2 interactors)

Partner (UniProt)		IntAct	Confidence score
O44739	BAG family molecular chaperone regulator 1	EBI-338285	0.00
P54812	Transitional endoplasmic reticulum ATPase homolog 2 (EC 3.6.4.6) (Cell division cycle-related protein 48.2) (p97/CDC48 homolog 2)	EBI-2414708	0.49

Cross-References

Database	Links
UNIPROT	Q9N2W5 Q86DD7
Pfam	PF08059 PF00789
PROSITE	PS51399 PS50033

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK