Sperm-associated antigen 4 protein - Homo sapiens

Sperm-associated antigen 4 protein (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Sperm-associated antigen 4 protein
Accession Code	Q9NPE6
Gene	SPAG4
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 437)
MRRSSRPGSASSSRKHTPNFFSENSSMSITSEDSKGLRSAEPGPGEPEGRRARGPSCGEPALSAGVPGGTTWAGSSQQKPAPRSHNWQTACGAATVRGGASEPTGSPVVSEEPLDLLPTLDLRQEMPPPR VFKSFLSLLFQGLSVLLSLAGDVLVSMYREVCSIRFLFTAVSLLSLFLSAFWLGLLYLVSPLENEPKEMLTLSEYHERVRSQGQQLQQLQAELDKLHKEVSTVRAANSERVAKLVFQRLNEDFVRKPDYA LSSVGASIDLQKTSHDYADRNTAYFWNRFSFWNYARPPTVILEPHVFPGNCWAFEGDQGQVVIQLPGRVQLSDITLQHPPPSVEHTGGANSAPRDFAVFGLQVYDETEVSLGKFTFDVEKSEIQTFHLQN DPPAAFPKVKIQILSNWGHPRFTCLYRVRAHGVRTSEGAEGSAQGPH

Subcellular Location

Description
Membrane {Curator Inference}; Multi-pass membrane protein {Curator Inference}. Cytoplasm, cytoskeleton {By SimilarityUniProtKB:O55034}. Cytoplasm, cytoskeleton, flagellum axoneme {By SimilarityUniProtKB:O55034}. Nucleus envelope {ECO:0000250\|UniProtKB:Q9JJF2}. Nucleus inner membrane {ECO:0000250\|UniProtKB:Q9JJF2}. Note=In spermatids, it is localized in the transient manchette and in the axoneme of elongating spermatids and epididymal sperm (By similarity). Colocalized with SEPT12 at the nuclear periphery in round spermatids, at sperm neck in elongated spermatids and at midpiece regions in ejaculated spermatozoa (PubMed:25775403). {By SimilarityUniProtKB:O55034, ECO:0000269\|PubMed:25775403}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Inner Membrane	SL-0179	The inner membrane of the nucleus is the membrane which separates the nuclear matrix from the intermembrane space. In mammals, the inner nuclear membrane is associated with heterochromatin and the nuclear lamina.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Cytoskeleton (GO:0005856) Obsolete Integral Component Of Nuclear Inner Membrane (GO:0005639) Meiotic Nuclear Membrane Microtubule Tethering Complex (GO:0034993) Motile Cilium (GO:0031514) Nuclear Envelope (GO:0005635)

Biology & Function

Description
Involved in spermatogenesis. Required for sperm head formation but not required to establish and maintain general polarity of the sperm head. Required for anchoring and organization of the manchette. Required for targeting of SUN3 and probably SYNE1 through a probable SUN1:SYNE3 LINC complex to the nuclear envelope and involved in accurate posterior sperm head localization of the complex. May anchor SUN3 the nuclear envelope. Involved in maintenance of the nuclear envelope integrity. May assist the organization and assembly of outer dense fibers (ODFs), a specific structure of the sperm tail. {By SimilarityUniProtKB:O55034, By SimilarityUniProtKB:Q9JJF2}.
Assigned Ontology terms

Biological Process	Cell Differentiation (GO:0030154) Nuclear Envelope Organization (GO:0006998) Spermatogenesis (GO:0007283)
Molecular Function	Protein-Membrane Adaptor Activity (GO:0043495) Structural Molecule Activity (GO:0005198)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (4 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q8TC36	SUN domain-containing protein 5	EBI-24639374	0.56
Q9BXJ8	Ion channel TACAN	EBI-22744045	0.56
Q9H2S6	Tenomodulin	EBI-24572530	0.56
Q8IXM6	Nurim	EBI-24640159	0.56
Interactions with other proteins (23 interactors)

Partner (UniProt)		IntAct	Confidence score
Q8IYM1	Septin-12	EBI-10819487	0.61
O95870	Phosphatidylserine lipase ABHD16A (EC 3.1.-.-) (Alpha/beta hydrolase domain-containing protein 16A) (Abhydrolase domain-containing protein 16A) (HLA-B-associated transcript 5) (hBAT5) (Monoacylglycerol lipase ABHD16A) (EC 3.1.1.23) (Protein G5)	EBI-24265964	0.56
Q9H2L4	Transmembrane protein 60	EBI-24266054	0.56
Q6UX98	Probable palmitoyltransferase ZDHHC24 (EC 2.3.1.225) (Zinc finger DHHC domain-containing protein 24)	EBI-22746269	0.56
Q8IWU4	Zinc transporter 8 (ZnT-8) (Solute carrier family 30 member 8)	EBI-22747198	0.56
P0DJD7	Pepsin A-4 (EC 3.4.23.1) (Pepsinogen-4)	EBI-24267883	0.56
P78329	Cytochrome P450 4F2 (EC 1.14.14.1) (20-hydroxyeicosatetraenoic acid synthase) (20-HETE synthase) (Arachidonic acid omega-hydroxylase) (CYPIVF2) (Cytochrome P450-LTB-omega) (Docosahexaenoic acid omega-hydroxylase) (EC 1.14.14.79) (Leukotriene-B(4) 20-monooxygenase 1) (Leukotriene-B(4) omega-hydroxylase 1) (EC 1.14.14.94) (Phylloquinone omega-hydroxylase CYP4F2) (EC 1.14.14.78)	EBI-22747716	0.56
O14653	Golgi SNAP receptor complex member 2 (27 kDa Golgi SNARE protein) (Membrin)	EBI-24510927	0.56
P07306	Asialoglycoprotein receptor 1 (ASGP-R 1) (ASGPR 1) (C-type lectin domain family 4 member H1) (Hepatic lectin H1) (HL-1)	EBI-24514111	0.56
P24593	Insulin-like growth factor-binding protein 5 (IBP-5) (IGF-binding protein 5) (IGFBP-5)	EBI-24520110	0.56
Q5TGU0	Translocator protein 2 (Peripheral-type benzodiazepine receptor-like protein 1)	EBI-24524123	0.56
Q5J8X5	Membrane-spanning 4-domains subfamily A member 13 (Testis-expressed transmembrane protein 4)	EBI-24529588	0.56
Q96GQ5	RUS family member 1	EBI-24610016	0.56
O00767	Stearoyl-CoA desaturase (hSCD1) (EC 1.14.19.1) (Acyl-CoA desaturase) (Delta(9)-desaturase) (Delta-9 desaturase) (Fatty acid desaturase)	EBI-24626536	0.56
Q14656	Transmembrane protein 187 (Protein ITBA1)	EBI-24535767	0.56
P43378	Tyrosine-protein phosphatase non-receptor type 9 (EC 3.1.3.48) (Protein-tyrosine phosphatase MEG2) (PTPase MEG2)	EBI-24536184	0.56
Q96IW7	Vesicle-trafficking protein SEC22a (SEC22 vesicle-trafficking protein homolog A) (SEC22 vesicle-trafficking protein-like 2)	EBI-24547117	0.56
O95393	Bone morphogenetic protein 10 (BMP-10)	EBI-24551734	0.56
Q969E2	Secretory carrier-associated membrane protein 4 (Secretory carrier membrane protein 4)	EBI-24579620	0.56
Q8TDX6	Chondroitin sulfate N-acetylgalactosaminyltransferase 1 (CsGalNAcT-1) (EC 2.4.1.174) (Chondroitin beta-1,4-N-acetylgalactosaminyltransferase 1) (Beta4GalNAcT-1)	EBI-24580321	0.56
Q7Z2K6	Endoplasmic reticulum metallopeptidase 1 (EC 3.4.-.-) (Felix-ina)	EBI-24591721	0.56
P26678	Cardiac phospholamban (PLB)	EBI-24597706	0.56
A5PKU2	TUSC5 protein	EBI-24637775	0.56

Cross-References

Database	Links
UNIPROT	Q9NPE6 O43648
Pfam	PF07738
PROSITE	PS51469
OMIM	603038
DisGeNET	6676

Sperm-associated antigen 4 protein (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (4 interactors)

Interactions with other proteins (23 interactors)

Cross-References

Database

Links

Description

Description