Protein Information |
|
|---|---|
| Protein Name | Exocyst complex component 1 |
| Accession Code | Q9NV70 |
| Gene | EXOC1 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 894) | |
|
MTAIKHALQRDIFTPNDERLLSIVNVCKAGKKKKNCFLCATVTTERPVQVKVVKVKKSDKGDFYKRQIAWALRDLAVVDAKDAIKENPEFDLHFEKIYKWVASSTAEKNAFISCIWKLNQRYLRKKIDFV NVSSQLLEESVPSGENQSVTGGDEEVVDEYQELNAREEQDIEIMMEGCEYAISNAEAFAEKLSRELQVLDGANIQSIMASEKQVNILMKLLDEALKEVDQIELKLSSYEEMLQSVKEQMDQISESNHLIH LSNTNNVKLLSEIEFLVNHMDLAKGHIKALQEGDLASSRGIEACTNAADALLQCMNVALRPGHDLLLAVKQQQQRFSDLRELFARRLASHLNNVFVQQGHDQSSTLAQHSVELTLPNHHPFHRDLLRYAK LMEWLKSTDYGKYEGLTKNYMDYLSRLYEREIKDFFEVAKIKMTGTTKESKKFATLPRKESAVKQETESLHGSSGKLTGSTSSLNKLSVQSSGNRRSQSSSLLDMGNMSASDLDVADRTKFDKIFEQVLS ELEPLCLAEQDFISKFFKLQQHQSMPGTMAEAEDLDGGTLSRQHNCGTPLPVSSEKDMIRQMMIKIFRCIEPELNNLIALGDKIDSFNSLYMLVKMSHHVWTAQNVDPASFLSTTLGNVLVTVKRNFDKC ISNQIRQMEEVKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFVNVEKVANESQKTPRDVVMMENFHHIFATLSRLKISCLEAEKKEAKQKYTDHLQSYVIYSLGQPLEKLNH FFEGVEARVAQGIREEEVSYQLAFNKQELRKVIKEYPGKEVKKGLDNLYKKVDKHLCEEENLLQVVWHSMQDEFIRQYKHFEGLIARCYPGSGVTMEFTIQDILDYCSSIAQSH |
|
Description |
||
|---|---|---|
| Midbody, Midbody ring {Experimental EvidencePubMed:16213214}. Cytoplasm {Experimental EvidencePubMed:16181645, Experimental EvidencePubMed:19889084}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:19889084}. Cell membrane {Experimental EvidencePubMed:16181645}. Note=Colocalizes with CNTRL/centriolin at the midbody ring (PubMed:16213214). Localizes in cell membrane in the presence of SLC6A9 (PubMed:16181645). {Experimental EvidencePubMed:16181645, Experimental EvidencePubMed:16213214}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Cytoplasm (GO:0005737) Cytoplasmic Side Of Apical Plasma Membrane (GO:0098592) Cytosol (GO:0005829) Exocyst (GO:0000145) Flemming Body (GO:0090543) Membrane (GO:0016020) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) |
|
Description |
|
|---|---|
| Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane. (Microbial infection) Has an antiviral effect against flaviviruses by affecting viral RNA transcription and translation through the sequestration of elongation factor 1-alpha (EEF1A1). This results in decreased viral RNA synthesis and decreased viral protein translation. {Experimental EvidencePubMed:19889084}. | Assigned Ontology terms |
| Biological Process | Defense Response To Virus (GO:0051607) Exocytosis (GO:0006887) Golgi To Plasma Membrane Transport (GO:0006893) Membrane Fission (GO:0090148) Mitotic Cytokinesis (GO:0000281) Phosphatidylinositol-Mediated Signaling (GO:0048015) Positive Regulation Of Protein Secretion (GO:0050714) Protein Transport (GO:0015031) Regulation Of Macroautophagy (GO:0016241) Vesicle Docking Involved In Exocytosis (GO:0006904) Vesicle Tethering Involved In Exocytosis (GO:0090522) |
| Molecular Function | Phosphatidylinositol-4,5-Bisphosphate Binding (GO:0005546) |
Interactions with Nuclear Envelope proteins (10 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| O60645 | Exocyst complex component 3 | EBI-12449995 | 0.51 |
| O95295 | SNARE-associated protein Snapin | EBI-21673234 | 0.35 |
| Q12840 | Kinesin heavy chain isoform 5A | EBI-21673234 | 0.35 |
| Q7Z3B4 | Nucleoporin p54 | EBI-24426768 | 0.67 |
| Q8IX03 | Protein KIBRA | EBI-15812551 | 0.41 |
| Q8IYI6 | Exocyst complex component 8 | EBI-12450194 | 0.51 |
| Q8NF91 | Nesprin-1 | EBI-21375821 | 0.00 |
| Q8TAG9 | Exocyst complex component 6 | EBI-12449995 | 0.51 |
| Q8WXH0 | Nesprin-2 | EBI-21375239 | 0.00 |
| Q03001 | Dystonin | EBI-1105725 | 0.00 | Interactions with other proteins (131 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| P01106 | Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) | EBI-1062888 | 0.00 |
| Q9BZD4 | Kinetochore protein Nuf2 (hNuf2) (hNuf2R) (hsNuf2) (Cell division cycle-associated protein 1) | EBI-21673234 | 0.35 |
| Q5KU26 | Collectin-12 (Collectin placenta protein 1) (CL-P1) (hCL-P1) (Nurse cell scavenger receptor 2) (Scavenger receptor class A member 4) (Scavenger receptor with C-type lectin) | EBI-1105596 | 0.00 |
| Q9HCM1 | Retroelement silencing factor 1 | EBI-1105801 | 0.00 |
| Q13439 | Golgin subfamily A member 4 (256 kDa golgin) (Golgin-245) (Protein 72.1) (Trans-Golgi p230) | EBI-21673234 | 0.35 |
| Q9H7U1 | Serine-rich coiled-coil domain-containing protein 2 (Coiled-coil serine-rich protein 2) (Protein GCAP14 homolog) | EBI-1105914 | 0.00 |
| Q9C0D2 | Centrosomal protein of 295 kDa | EBI-1105940 | 0.00 |
| Q9UPN3 | Microtubule-actin cross-linking factor 1, isoforms 1/2/3/4/5 (620 kDa actin-binding protein) (ABP620) (Actin cross-linking family protein 7) (Macrophin-1) (Trabeculin-alpha) | EBI-1106060 | 0.00 |
| Q9NRI5 | Disrupted in schizophrenia 1 protein | EBI-1106277 | 0.00 |
| Q96A65 | Exocyst complex component 4 (Exocyst complex component Sec8) | EBI-12449995 | 0.80 |
| O60239 | SH3 domain-binding protein 5 (SH3BP-5) (SH3 domain-binding protein that preferentially associates with BTK) | EBI-1106308 | 0.00 |
| Q13813 | Spectrin alpha chain, non-erythrocytic 1 (Alpha-II spectrin) (Fodrin alpha chain) (Spectrin, non-erythroid alpha subunit) | EBI-1106390 | 0.00 |
| Q9C026 | E3 ubiquitin-protein ligase TRIM9 (EC 2.3.2.27) (RING finger protein 91) (RING-type E3 ubiquitin transferase TRIM9) (Tripartite motif-containing protein 9) | EBI-1106505 | 0.00 |
| O75962 | Triple functional domain protein (EC 2.7.11.1) (PTPRF-interacting protein) | EBI-1106525 | 0.00 |
| Q5NH32 | Dihydroxy-acid dehydratase (DAD) (EC 4.2.1.9) | EBI-2806981 | 0.00 |
| Q13573 | SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein) | EBI-7950968 | 0.35 |
| Q80U62 | Run domain Beclin-1-interacting and cysteine-rich domain-containing protein (Rubicon) | EBI-3506571 | 0.40 |
| Q8CDJ3 | Beclin 1-associated autophagy-related key regulator (Barkor) (Autophagy-related protein 14-like protein) (Atg14L) | EBI-3506695 | 0.40 |
| Q15051 | IQ calmodulin-binding motif-containing protein 1 (Nephrocystin-5) (p53 and DNA damage-regulated IQ motif protein) (PIQ) | EBI-4286917 | 0.64 |
| A8K0Z3 | WASH complex subunit 1 (CXYorf1-like protein on chromosome 9) (Protein FAM39E) (WAS protein family homolog 1) | EBI-9075674 | 0.51 |
| Q6P5D4 | Centrosomal protein of 135 kDa (Cep135) (Centrosomal protein 4) | EBI-10991106 | 0.35 |
| P48039 | Melatonin receptor type 1A (Mel-1A-R) (Mel1a receptor) | EBI-11578238 | 0.00 |
| Q96KP1 | Exocyst complex component 2 (Exocyst complex component Sec5) | EBI-12449995 | 0.80 |
| O95721 | Synaptosomal-associated protein 29 (SNAP-29) (Soluble 29 kDa NSF attachment protein) (Vesicle-membrane fusion protein SNAP-29) | EBI-12449995 | 0.51 |
| Q13445 | Transmembrane emp24 domain-containing protein 1 (Interleukin-1 receptor-like 1 ligand) (Putative T1/ST2 receptor-binding protein) (p24 family protein gamma-1) (Tp24) (p24gamma1) | EBI-12449995 | 0.51 |
| Q9UEU0 | Vesicle transport through interaction with t-SNAREs homolog 1B (Vesicle transport v-SNARE protein Vti1-like 1) (Vti1-rp1) | EBI-12449995 | 0.51 |
| Q9UPT5 | Exocyst complex component 7 (Exocyst complex component Exo70) | EBI-12449995 | 0.51 |
| Q53HC9 | EARP and GARP complex-interacting protein 1 (Endosome-associated recycling protein-interacting protein) (Golgi-associated retrograde protein-interacting protein) (Tumor-suppressing STF cDNA 1 protein) (Tumor-suppressing subchromosomal transferable fragment candidate gene 1 protein) | EBI-12449995 | 0.51 |
| Q13049 | E3 ubiquitin-protein ligase TRIM32 (EC 2.3.2.27) (72 kDa Tat-interacting protein) (RING-type E3 ubiquitin transferase TRIM32) (Tripartite motif-containing protein 32) (Zinc finger protein HT2A) | EBI-12449995 | 0.51 |
| O00471 | Exocyst complex component 5 (Exocyst complex component Sec10) (hSec10) | EBI-12449995 | 0.51 |
| Q9H5N1 | Rab GTPase-binding effector protein 2 (Rabaptin-5beta) | EBI-12449995 | 0.51 |
| Q9Y2D4 | Exocyst complex component 6B (Exocyst complex component Sec15B) (SEC15-like protein 2) | EBI-12450145 | 0.51 |
| Q8TD31 | Coiled-coil alpha-helical rod protein 1 (Alpha-helical coiled-coil rod protein) (Putative gene 8 protein) (Pg8) | EBI-24359951 | 0.56 |
| P18848 | Cyclic AMP-dependent transcription factor ATF-4 (cAMP-dependent transcription factor ATF-4) (Activating transcription factor 4) (Cyclic AMP-responsive element-binding protein 2) (CREB-2) (cAMP-responsive element-binding protein 2) (Tax-responsive enhancer element-binding protein 67) (TaxREB67) | EBI-22734600 | 0.56 |
| P11234 | Ras-related protein Ral-B (EC 3.6.5.2) | EBI-11934086 | 0.00 |
| O36551 | Glycoprotein K8.1 (Glycoprotein K8.1A) (Glycoprotein gp35/37) (K8.1) (K8.1 protein) | EBI-14062552 | 0.35 |
| P35414 | Apelin receptor (Angiotensin receptor-like 1) (G-protein coupled receptor APJ) (G-protein coupled receptor HG11) | EBI-21559824 | 0.35 |
| Q96EV8 | Dysbindin (Biogenesis of lysosome-related organelles complex 1 subunit 8) (BLOC-1 subunit 8) (Dysbindin-1) (Dystrobrevin-binding protein 1) (Hermansky-Pudlak syndrome 7 protein) (HPS7 protein) | EBI-21651992 | 0.35 |
| P27930 | Interleukin-1 receptor type 2 (IL-1R-2) (IL-1RT-2) (IL-1RT2) (CD121 antigen-like family member B) (CDw121b) (IL-1 type II receptor) (Interleukin-1 receptor beta) (IL-1R-beta) (Interleukin-1 receptor type II) (CD antigen CD121b) [Cleaved into: Interleukin-1 receptor type 2, membrane form (mIL-1R2) (mIL-1RII); Interleukin-1 receptor type 2, soluble form (sIL-1R2) (sIL-1RII)] | EBI-21662122 | 0.35 |
| P24530 | Endothelin receptor type B (ET-B) (ET-BR) (Endothelin receptor non-selective type) | EBI-21672284 | 0.35 |
| O95229 | ZW10 interactor (ZW10-interacting protein 1) (Zwint-1) | EBI-21673234 | 0.35 |
| Q9UJ41 | Rab5 GDP/GTP exchange factor (RAP1) (Rabaptin-5-associated exchange factor for Rab5) (Rabex-5) | EBI-21673234 | 0.35 |
| Q9Y2X7 | ARF GTPase-activating protein GIT1 (ARF GAP GIT1) (Cool-associated and tyrosine-phosphorylated protein 1) (CAT-1) (CAT1) (G protein-coupled receptor kinase-interactor 1) (GRK-interacting protein 1) (p95-APP1) | EBI-21673234 | 0.35 |
| Q9UID3 | Vacuolar protein sorting-associated protein 51 homolog (Another new gene 2 protein) (Protein fat-free homolog) | EBI-21673234 | 0.35 |
| Q9NUP1 | Biogenesis of lysosome-related organelles complex 1 subunit 4 (BLOC-1 subunit 4) (Protein cappuccino homolog) | EBI-21673234 | 0.35 |
| Q9NNX1 | Tuftelin | EBI-21673234 | 0.35 |
| Q9BRV8 | Suppressor of IKBKE 1 (Suppressor of IKK-epsilon) | EBI-21673234 | 0.35 |
| Q9BQD3 | KxDL motif-containing protein 1 | EBI-21673234 | 0.35 |
| Q96JG6 | Syndetin (Coiled-coil domain-containing protein 132) (EARP/GARPII complex subunit VPS50) | EBI-21673234 | 0.35 |
| Q96EK4 | THAP domain-containing protein 11 | EBI-21673234 | 0.35 |
| Q96BD5 | PHD finger protein 21A (BHC80a) (BRAF35-HDAC complex protein BHC80) | EBI-21673234 | 0.35 |
| Q8TBA6 | Golgin subfamily A member 5 (Cell proliferation-inducing gene 31 protein) (Golgin-84) (Protein Ret-II) (RET-fused gene 5 protein) | EBI-21673234 | 0.35 |
| Q6S8J3 | POTE ankyrin domain family member E (ANKRD26-like family C member 1A) (Prostate, ovary, testis-expressed protein on chromosome 2) (POTE-2) | EBI-21673234 | 0.35 |
| Q6QNY1 | Biogenesis of lysosome-related organelles complex 1 subunit 2 (BLOC-1 subunit 2) (Centrosome-associated protein) | EBI-21673234 | 0.35 |
| Q6NZI2 | Caveolae-associated protein 1 (Cavin-1) (Polymerase I and transcript release factor) | EBI-21673234 | 0.35 |
| Q5VIR6 | Vacuolar protein sorting-associated protein 53 homolog | EBI-21673234 | 0.35 |
| Q5T1M5 | FK506-binding protein 15 (FKBP-15) (133 kDa FK506-binding protein) (133 kDa FKBP) (FKBP-133) (WASP- and FKBP-like protein) (WAFL) | EBI-21673234 | 0.35 |
| Q5T0U0 | Coiled-coil domain-containing protein 122 | EBI-21673234 | 0.35 |
| Q5R372 | Rab GTPase-activating protein 1-like | EBI-21673234 | 0.35 |
| Q4V328 | GRIP1-associated protein 1 (GRASP-1) [Cleaved into: GRASP-1 C-terminal chain (30kDa C-terminus form)] | EBI-21673234 | 0.35 |
| Q16204 | Coiled-coil domain-containing protein 6 (Papillary thyroid carcinoma-encoded protein) (Protein H4) | EBI-21673234 | 0.35 |
| Q15276 | Rab GTPase-binding effector protein 1 (Rabaptin-4) (Rabaptin-5) (Rabaptin-5alpha) (Renal carcinoma antigen NY-REN-17) | EBI-21673234 | 0.35 |
| Q15025 | TNFAIP3-interacting protein 1 (A20-binding inhibitor of NF-kappa-B activation 1) (ABIN-1) (HIV-1 Nef-interacting protein) (Nef-associated factor 1) (Naf1) (Nip40-1) (Virion-associated nuclear shuttling protein) (VAN) (hVAN) | EBI-21673234 | 0.35 |
| Q14161 | ARF GTPase-activating protein GIT2 (ARF GAP GIT2) (Cool-interacting tyrosine-phosphorylated protein 2) (CAT-2) (CAT2) (G protein-coupled receptor kinase-interactor 2) (GRK-interacting protein 2) | EBI-21673234 | 0.35 |
| Q14155 | Rho guanine nucleotide exchange factor 7 (Beta-Pix) (COOL-1) (PAK-interacting exchange factor beta) (p85) | EBI-21673234 | 0.35 |
| Q13107 | Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.4.19.12) (Deubiquitinating enzyme 4) (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Ubiquitous nuclear protein homolog) | EBI-21673234 | 0.35 |
| Q13033 | Striatin-3 (Cell cycle autoantigen SG2NA) (S/G2 antigen) | EBI-21673234 | 0.35 |
| P33176 | Kinesin-1 heavy chain (Conventional kinesin heavy chain) (Ubiquitous kinesin heavy chain) (UKHC) | EBI-21673234 | 0.35 |
| P05412 | Transcription factor Jun (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (Transcription factor AP-1 subunit Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39) | EBI-21673234 | 0.35 |
| O95613 | Pericentrin (Kendrin) (Pericentrin-B) | EBI-21673234 | 0.35 |
| O60282 | Kinesin heavy chain isoform 5C (EC 3.6.4.-) (Kinesin heavy chain neuron-specific 2) (Kinesin-1) | EBI-21673234 | 0.35 |
| O43815 | Striatin | EBI-21673234 | 0.35 |
| O15516 | Circadian locomoter output cycles protein kaput (hCLOCK) (EC 2.3.1.48) (Class E basic helix-loop-helix protein 8) (bHLHe8) | EBI-21673234 | 0.35 |
| O14777 | Kinetochore protein NDC80 homolog (Highly expressed in cancer protein) (Kinetochore protein Hec1) (HsHec1) (Kinetochore-associated protein 2) (Retinoblastoma-associated protein HEC) | EBI-21673234 | 0.35 |
| Q9Y2V7 | Conserved oligomeric Golgi complex subunit 6 (COG complex subunit 6) (Component of oligomeric Golgi complex 6) | EBI-21673529 | 0.35 |
| Q9UJT2 | Testis-specific serine kinase substrate (Testis-specific kinase substrate) (STK22 substrate 1) | EBI-21696311 | 0.35 |
| P28908 | Tumor necrosis factor receptor superfamily member 8 (CD30L receptor) (Ki-1 antigen) (Lymphocyte activation antigen CD30) (CD antigen CD30) | EBI-21750180 | 0.35 |
| Q70UQ0 | Inhibitor of nuclear factor kappa-B kinase-interacting protein (I kappa-B kinase-interacting protein) (IKBKB-interacting protein) (IKK-interacting protein) | EBI-21813594 | 0.35 |
| Q9BT49 | THAP domain-containing protein 7 | EBI-21869056 | 0.35 |
| Q9NPJ6 | Mediator of RNA polymerase II transcription subunit 4 (Activator-recruited cofactor 36 kDa component) (ARC36) (Mediator complex subunit 4) (TRAP/SMCC/PC2 subunit p36 subunit) (Vitamin D3 receptor-interacting protein complex 36 kDa component) (DRIP36) | EBI-25472377 | 0.35 |
| Q9Y275 | Tumor necrosis factor ligand superfamily member 13B (B lymphocyte stimulator) (BLyS) (B-cell-activating factor) (BAFF) (Dendritic cell-derived TNF-like molecule) (TNF- and APOL-related leukocyte expressed ligand 1) (TALL-1) (CD antigen CD257) [Cleaved into: Tumor necrosis factor ligand superfamily member 13b, membrane form; Tumor necrosis factor ligand superfamily member 13b, soluble form] | EBI-21266480 | 0.35 |
| Q9H1C4 | Protein unc-93 homolog B1 (Unc-93B1) (hUNC93B1) | EBI-21266770 | 0.35 |
| Q9UP83 | Conserved oligomeric Golgi complex subunit 5 (COG complex subunit 5) (13S Golgi transport complex 90 kDa subunit) (GTC-90) (Component of oligomeric Golgi complex 5) (Golgi transport complex 1) | EBI-21370112 | 0.00 |
| O14795 | Protein unc-13 homolog B (Munc13-2) (munc13) | EBI-21370190 | 0.00 |
| Q96RF0 | Sorting nexin-18 (SH3 and PX domain-containing protein 3B) | EBI-21371429 | 0.00 |
| Q86XK3 | Swi5-dependent recombination DNA repair protein 1 homolog (Meiosis protein 5 homolog) | EBI-21371888 | 0.00 |
| Q8TAB5 | UPF0500 protein C1orf216 | EBI-21372100 | 0.00 |
| A0AUZ9 | KAT8 regulatory NSL complex subunit 1-like protein (MSL1v2) | EBI-21372770 | 0.00 |
| Q7Z6K1 | THAP domain-containing protein 5 | EBI-21373121 | 0.00 |
| O60341 | Lysine-specific histone demethylase 1A (EC 1.14.99.66) (BRAF35-HDAC complex protein BHC110) (Flavin-containing amine oxidase domain-containing protein 2) ([histone H3]-dimethyl-L-lysine(4) FAD-dependent demethylase 1A) | EBI-21374572 | 0.00 |
| Q9NYJ8 | TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 (Mitogen-activated protein kinase kinase kinase 7-interacting protein 2) (TAK1-binding protein 2) (TAB-2) (TGF-beta-activated kinase 1-binding protein 2) | EBI-21374944 | 0.00 |
| Q08AD1 | Calmodulin-regulated spectrin-associated protein 2 (Calmodulin-regulated spectrin-associated protein 1-like protein 1) | EBI-21375463 | 0.00 |
| O75044 | SLIT-ROBO Rho GTPase-activating protein 2 (srGAP2) (Formin-binding protein 2) (Rho GTPase-activating protein 34) | EBI-21376088 | 0.00 |
| O94822 | E3 ubiquitin-protein ligase listerin (EC 2.3.2.27) (RING finger protein 160) (RING-type E3 ubiquitin transferase listerin) (Zinc finger protein 294) | EBI-21377108 | 0.00 |
| Q9UIF3 | Tektin-2 (Tektin-t) (Testicular tektin) (Testicular tektin B1-like protein) (TEKTB1) (Tektin-B1) | EBI-21377680 | 0.00 |
| Q96JM3 | Chromosome alignment-maintaining phosphoprotein 1 (Zinc finger protein 828) | EBI-21378253 | 0.00 |
| Q8WYA0 | Intraflagellar transport protein 81 homolog (Carnitine deficiency-associated protein expressed in ventricle 1) (CDV-1) | EBI-21378706 | 0.00 |
| P28330 | Long-chain specific acyl-CoA dehydrogenase, mitochondrial (LCAD) (EC 1.3.8.8) | EBI-21379260 | 0.00 |
| Q14197 | Peptidyl-tRNA hydrolase ICT1, mitochondrial (EC 3.1.1.29) (39S ribosomal protein L58, mitochondrial) (MRP-L58) (Digestion substraction 1) (DS-1) (Immature colon carcinoma transcript 1 protein) (Mitochondrial large ribosomal subunit protein mL62) | EBI-21379436 | 0.00 |
| Q14571 | Inositol 1,4,5-trisphosphate receptor type 2 (IP3 receptor isoform 2) (IP3R 2) (InsP3R2) (Type 2 inositol 1,4,5-trisphosphate receptor) (Type 2 InsP3 receptor) | EBI-21379754 | 0.00 |
| Q6ZTA4 | Tripartite motif-containing protein 67 (TRIM9-like protein) | EBI-21380545 | 0.00 |
| O15230 | Laminin subunit alpha-5 (Laminin-10 subunit alpha) (Laminin-11 subunit alpha) (Laminin-15 subunit alpha) | EBI-21380204 | 0.00 |
| Q14980 | Nuclear mitotic apparatus protein 1 (Nuclear matrix protein-22) (NMP-22) (Nuclear mitotic apparatus protein) (NuMA protein) (SP-H antigen) | EBI-21380995 | 0.00 |
| Q9ULH1 | Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (130 kDa phosphatidylinositol 4,5-bisphosphate-dependent ARF1 GTPase-activating protein) (ADP-ribosylation factor-directed GTPase-activating protein 1) (ARF GTPase-activating protein 1) (Development and differentiation-enhancing factor 1) (DEF-1) (Differentiation-enhancing factor 1) (PIP2-dependent ARF1 GAP) | EBI-21381430 | 0.00 |
| Q9NR80 | Rho guanine nucleotide exchange factor 4 (APC-stimulated guanine nucleotide exchange factor 1) (Asef) (Asef1) | EBI-21381244 | 0.00 |
| Q9Y383 | Putative RNA-binding protein Luc7-like 2 | EBI-21381969 | 0.00 |
| Q567U6 | Coiled-coil domain-containing protein 93 | EBI-21382571 | 0.00 |
| Q5T0N5 | Formin-binding protein 1-like (Transducer of Cdc42-dependent actin assembly protein 1) (Toca-1) | EBI-21382805 | 0.00 |
| Q9NX95 | Syntabulin (Golgi-localized syntaphilin-related protein) (Syntaxin-1-binding protein) | EBI-21383531 | 0.00 |
| Q7Z4S6 | Kinesin-like protein KIF21A (Kinesin-like protein KIF2) (Renal carcinoma antigen NY-REN-62) | EBI-21383490 | 0.00 |
| Q3V6T2 | Girdin (Akt phosphorylation enhancer) (APE) (Coiled-coil domain-containing protein 88A) (G alpha-interacting vesicle-associated protein) (GIV) (Girders of actin filament) (Hook-related protein 1) (HkRP1) | EBI-21383689 | 0.00 |
| Q8WXA3 | RUN and FYVE domain-containing protein 2 (Rab4-interacting protein related) | EBI-21383580 | 0.00 |
| Q99459 | Cell division cycle 5-like protein (Cdc5-like protein) (Pombe cdc5-related protein) | EBI-21383874 | 0.00 |
| Q8TDR0 | TRAF3-interacting protein 1 (Interleukin-13 receptor alpha 1-binding protein 1) (Intraflagellar transport protein 54 homolog) (Microtubule-interacting protein associated with TRAF3) (MIP-T3) | EBI-21383847 | 0.00 |
| Q96SN8 | CDK5 regulatory subunit-associated protein 2 (CDK5 activator-binding protein C48) (Centrosome-associated protein 215) | EBI-21383834 | 0.00 |
| Q8N2N9 | Ankyrin repeat domain-containing protein 36B (CLL-associated antigen KW-1) | EBI-21385250 | 0.00 |
| Q8IYE0 | Coiled-coil domain-containing protein 146 | EBI-21385113 | 0.00 |
| Q7Z6B7 | SLIT-ROBO Rho GTPase-activating protein 1 (srGAP1) (Rho GTPase-activating protein 13) | EBI-21384976 | 0.00 |
| Q49A88 | Coiled-coil domain-containing protein 14 | EBI-21386371 | 0.00 |
| P53804 | E3 ubiquitin-protein ligase TTC3 (EC 2.3.2.27) (Protein DCRR1) (RING finger protein 105) (RING-type E3 ubiquitin transferase TTC3) (TPR repeat protein D) (Tetratricopeptide repeat protein 3) (TPR repeat protein 3) | EBI-21388051 | 0.00 |
| Q8IYT3 | Coiled-coil domain-containing protein 170 | EBI-21389251 | 0.00 |
| P55197 | Protein AF-10 (ALL1-fused gene from chromosome 10 protein) | EBI-21389515 | 0.00 |
| Q9H2F5 | Enhancer of polycomb homolog 1 | EBI-21389541 | 0.00 |
| Q9ULU8 | Calcium-dependent secretion activator 1 (Calcium-dependent activator protein for secretion 1) (CAPS-1) | EBI-21390808 | 0.00 |
| O43490 | Prominin-1 (Antigen AC133) (Prominin-like protein 1) (CD antigen CD133) | EBI-21391143 | 0.00 |
| P35609 | Alpha-actinin-2 (Alpha-actinin skeletal muscle isoform 2) (F-actin cross-linking protein) | EBI-21391067 | 0.00 |
| Q8NEY1 | Neuron navigator 1 (Pore membrane and/or filament-interacting-like protein 3) (Steerin-1) (Unc-53 homolog 1) (unc53H1) | EBI-21391441 | 0.00 |
| O15066 | Kinesin-like protein KIF3B (HH0048) (Microtubule plus end-directed kinesin motor 3B) [Cleaved into: Kinesin-like protein KIF3B, N-terminally processed] | EBI-21392232 | 0.00 |
| Q5NHH2 | Hypothetical lipoprotein | EBI-22298200 | 0.37 |
| Q5NGE3 | Lipoprotein | EBI-22298210 | 0.37 |
| O84008 | Uncharacterized protein CT_005 | EBI-22302433 | 0.35 |
Database | Links |
| UNIPROT | Q9NV70 Q504V4 Q8WUE7 Q96T15 Q9NZE4 |
| Pfam | PF15277 PF09763 |
| OMIM | 607879 |
| DisGeNET | 55763 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory