NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Calcium-binding protein 1 - Homo sapiens - NucEnvDB

Calcium-binding protein 1 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Calcium-binding protein 1
Accession Code	Q9NZU7
Gene	CABP1
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 370)
MGGGDGAAFKRPGDGARLQRVLGLGSRREPRSLPAGGPAPRRTAPPPPGHASAGPAAMSSHIAKSESKTSLLKAAAAAAS GGSRAPRHGPARDPGLPSRRLPGSCPATPQSSGDPSSRRPLCRPAPREEGARGSQRVLPQAHCRPREALPAAASRPSPSS PLPPARGRDGEERGLSPALGLRGSLRARGRGDSVPAAASEADPFLHRLRPMLSSAFGQDRSLRPEEIEELREAFREFDKD KDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDG EISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR

Structure Viewer (PDB: 2LAP)

Subcellular Location

Description
Cytoplasm, cytoskeleton {Experimental EvidencePubMed:10625670}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:14685260}. Cell membrane {Experimental EvidencePubMed:10625670, Experimental EvidencePubMed:14570872, Experimental EvidencePubMed:14685260}; Lipid-anchor; Cytoplasmic side. Golgi apparatus {Experimental EvidencePubMed:14570872, Experimental EvidencePubMed:14685260}. Postsynaptic density {ECO:0000305}. Note=L-CaBP1 is associated most likely with the cytoskeletal structures, whereas S-CaBP1 is localized at or near the plasma membrane. {Experimental EvidencePubMed:10625670}. [Isoform L-CaBP1]: Cytoplasm, cytoskeleton {Experimental EvidencePubMed:10625670}. Note=L-CaBP1 is associated most likely with the cytoskeletal structures. {Experimental EvidencePubMed:10625670}. [Isoform S-CaBP1]: Cytoplasm, cell cortex. Cell membrane {ECO:0000305\|PubMed:10625670}; Lipid-anchor {ECO:0000305}. Note=S-CaBP1 is localized at or near the plasma membrane.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Lipid-Anchored	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Anchoring Junction (GO:0070161) Cell Cortex (GO:0005938) Cytoplasm (GO:0005737) Cytoskeleton (GO:0005856) Extracellular Space (GO:0005615) Golgi Membrane (GO:0000139) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Postsynaptic Density (GO:0014069)

Biology & Function

Description
Modulates calcium-dependent activity of inositol 1,4,5- triphosphate receptors (ITPRs)(PubMed:14570872). Inhibits agonist- induced intracellular calcium signaling (PubMed:15980432). Enhances inactivation and does not support calcium-dependent facilitation of voltage-dependent P/Q-type calcium channels (PubMed:11865310). Causes calcium-dependent facilitation and inhibits inactivation of L-type calcium channels by binding to the same sites as calmodulin in the C- terminal domain of CACNA1C, but has an opposite effect on channel function (PubMed:15140941). Suppresses the calcium-dependent inactivation of CACNA1D (By similarity). Inhibits TRPC5 channels (PubMed:15895247). Prevents NMDA receptor-induced cellular degeneration. Required for the normal transfer of light signals through the retina (By similarity). {By SimilarityUniProtKB:O88751, By SimilarityUniProtKB:Q9JLK7, Experimental EvidencePubMed:11865310, Experimental EvidencePubMed:14570872, Experimental EvidencePubMed:15140941, Experimental EvidencePubMed:15895247, Experimental EvidencePubMed:15980432}.
Assigned Ontology terms

Biological Process	Negative Regulation Of Protein Import Into Nucleus (GO:0042308) Regulation Of Voltage-Gated Calcium Channel Activity (GO:1901385) Response To Stimulus (GO:0050896) Visual Perception (GO:0007601)
Molecular Function	Calcium Channel Regulator Activity (GO:0005246) Calcium Ion Binding (GO:0005509) Calcium-Dependent Protein Binding (GO:0048306) Enzyme Inhibitor Activity (GO:0004857) Nuclear Localization Sequence Binding (GO:0008139)

Protein-Protein Interactions

Interactions with other proteins (5 interactors)

Partner (UniProt)		IntAct	Confidence score
P06623	2',3'-cyclic-nucleotide 3'-phosphodiesterase (CNP) (CNPase) (EC 3.1.4.37) (Elastase 2',3'-cyclic-nucleotide 3'-phosphodiesterase)	EBI-907917	0.40
Q13936	Voltage-dependent L-type calcium channel subunit alpha-1C (Calcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac muscle) (Voltage-gated calcium channel subunit alpha Cav1.2)	EBI-15896764	0.54
P08047	Transcription factor Sp1	EBI-2679915	0.00
P01100	Protein c-Fos (Cellular oncogene fos) (Fos proto-oncogene, AP-1 transcription factor subunit) (G0/G1 switch regulatory protein 7) (Proto-oncogene c-Fos) (Transcription factor AP-1 subunit c-Fos)	EBI-2681402	0.00
Q13107	Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.4.19.12) (Deubiquitinating enzyme 4) (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Ubiquitous nuclear protein homolog)	EBI-21883326	0.40

Cross-References

Database	Links
UNIPROT	Q9NZU7 O95663 Q8N6H5 Q9NZU8
PDB	2K7B 2K7C 2K7D 2LAN 2LAP 3OX5 3OX6
Pfam	PF13499
PROSITE	PS00018 PS50222
OMIM	605563
DisGeNET	9478

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK