MVQSTVTVNGVKVASTHPQSAHISIHIHQKSALEQLLGAVGSLKKFLSWPQARIHYGQLSLGVTQILLGLVSCALGVCLYFGPWTELCAFGCAFWSGSVAILAGVGTIVHEKRQGKLSGQVSCLLLLACI ATAAAATVLGVNSLIRQTSVPYYVEIFSTCNPLQSSMDPGYGTVRYSDDSDWKTERCREYLNMMMNLFLAFCIMLTVVCILEIVVSVASLGLSLRSMYGRSSQALNEEESERKLLDGHPAPASPAKEKIP AIL
The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.