NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Vesicle-associated membrane protein-associated protein A - Mus musculus - NucEnvDB

Vesicle-associated membrane protein-associated protein A (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Vesicle-associated membrane protein-associated protein A
Accession Code	Q9WV55
Gene	Vapa
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 249)
MASASGAMAKHEQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSIVTVSVML QPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPLP KPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSAVSFRDNVTSPLPSLLVVIAAIFI GFFLGKFIL

Structure Viewer (PDB: 2CRI)

Subcellular Location

Description
Endoplasmic reticulum membrane {Experimental EvidencePubMed:10655491}; Single-pass type IV membrane protein {By SimilarityUniProtKB:Q9P0L0}. Cell membrane {By SimilarityUniProtKB:Q9P0L0}; Single-pass type IV membrane protein {Curator Inference}. Cell junction, tight junction {By SimilarityUniProtKB:Q9P0L0}. Nucleus membrane {ECO:0000250\|UniProtKB:Q9Z270}. Note=Present in the plasma membrane and in intracellular vesicles, together with SNARE proteins. May also associate with the cytoskeleton. Colocalizes with OCLN at the tight junction in polarized epithelial cells. {By SimilarityUniProtKB:Q9P0L0}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Bicellular Tight Junction (GO:0005923) Endoplasmic Reticulum (GO:0005783) Endoplasmic Reticulum Membrane (GO:0005789) Golgi Membrane (GO:0000139) Membrane (GO:0016020) Microtubule Cytoskeleton (GO:0015630) Nuclear Membrane (GO:0031965) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Vesicle (GO:0031982)

Biology & Function

Description
Binds to OSBPL3, which mediates recruitment of VAPA to plasma membrane sites. The ORP3-VAPA complex stimulates RRAS signaling which in turn attenuates integrin beta-1 (ITGB1) activation at the cell surface. With OSBPL3, may regulate ER morphology. May play a role in vesicle trafficking. {By SimilarityUniProtKB:Q9P0L0}.
Assigned Ontology terms

Biological Process	Cell Death (GO:0008219) Ceramide Transport (GO:0035627) COPII-Coated Vesicle Budding (GO:0090114) Endoplasmic Reticulum To Golgi Vesicle-Mediated Transport (GO:0006888) Negative Regulation By Host Of Viral Genome Replication (GO:0044828) Neuron Projection Development (GO:0031175) Phospholipid Transport (GO:0015914) Positive Regulation By Host Of Viral Genome Replication (GO:0044829) Protein Localization To Endoplasmic Reticulum (GO:0070972) Sphingomyelin Biosynthetic Process (GO:0006686) Sterol Transport (GO:0015918) Viral Release From Host Cell (GO:0019076)
Molecular Function	FFAT Motif Binding (GO:0033149) Identical Protein Binding (GO:0042802) Microtubule Binding (GO:0008017) Protein Domain Specific Binding (GO:0019904) Protein Heterodimerization Activity (GO:0046982) Protein-Containing Complex Binding (GO:0044877)

Protein-Protein Interactions

Interactions with other proteins (12 interactors)

Partner (UniProt)		IntAct	Confidence score
P25118	Tumor necrosis factor receptor superfamily member 1A (Tumor necrosis factor receptor 1) (TNF-R1) (Tumor necrosis factor receptor type I) (TNF-RI) (TNFR-I) (p55) (p60) (CD antigen CD120a)	EBI-654955	0.37
Q38SD2	Leucine-rich repeat serine/threonine-protein kinase 1 (EC 2.7.11.1)	EBI-2906701	0.35
P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	EBI-2909386	0.53
P68510	14-3-3 protein eta	EBI-8586548	0.35
Q9EPL2	Calsyntenin-1 (Alcadein-alpha) (Alc-alpha) [Cleaved into: Soluble Alc-alpha (SAlc-alpha); CTF1-alpha (C-terminal fragment 1-alpha)]	EBI-3869454	0.35
Q3TXX3	Protrudin (Zinc finger FYVE domain-containing protein 27)	EBI-3894232	0.40
P42866	Mu-type opioid receptor (M-OR-1) (MOR-1)	EBI-6919803	0.35
Q9QXM1	Junction-mediating and -regulatory protein	EBI-11475559	0.46
Q8QZZ8	Ras-related protein Rab-38	EBI-11569528	0.35
Q9CZE3	Ras-related protein Rab-32	EBI-11570633	0.35
Q6NZM9	Histone deacetylase 4 (HD4) (EC 3.5.1.98)	EBI-26471532	0.35
A0A0F6B423	Deubiquitinase	EBI-27035120	0.35

Cross-References

Database	Links
UNIPROT	Q9WV55 Q3TJM1 Q9QY77
PDB	2CRI
Pfam	PF00635
PROSITE	PS50202

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK